Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Human DCLK3 partial (162-632) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9C098
Molecular weight:
54.83kDa

Original price was: $361.00.Current price is: $308.00.

50ug 15% OFF + 308 loyalty points
Partial Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Human DCLK3 partial (162-632) Recombinant Protein

Product name Human Human DCLK3 partial (162-632) Recombinant Protein
Uniprot ID Q9C098
Uniprot link http://www.uniprot.org/uniprot/Q9C098
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGSELDMGKGPMYDVEKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAANVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILI
Molecular weight 54.83kDa
Protein delivered with Tag? Yes
Purity estimated 30%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_208382.1
Spec:Entrez GeneID 85443
Spec:NCBI Gene Aliases DCAMKL3, DCDC3C, DCK3, CLR
Spec:SwissProtID Q9C098
NCBI Reference NP_208382.1
Aliases /Synonyms Human DCLK3 partial (162-632), doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3 ou Doublecortin domain-containing protein 3C ou Doublecortin-like and CAM kinase-like 3 ou Doublecortin-like kinase 3
Reference PX-P2075
Note For research use only
Molecular Constructor
Partial Yes
Product name Human Human DCLK3 partial (162-632) Recombinant Protein
Uniprot ID Q9C098
Uniprot link http://www.uniprot.org/uniprot/Q9C098
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGSELDMGKGPMYDVEKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAANVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILI
Molecular weight 54.83kDa
Protein delivered with Tag? Yes
Purity estimated 30%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_208382.1
Spec:Entrez GeneID 85443
Spec:NCBI Gene Aliases DCAMKL3, DCDC3C, DCK3, CLR
Spec:SwissProtID Q9C098
NCBI Reference NP_208382.1
Aliases /Synonyms Human DCLK3 partial (162-632), doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3 ou Doublecortin domain-containing protein 3C ou Doublecortin-like and CAM kinase-like 3 ou Doublecortin-like kinase 3
Reference PX-P2075
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P2075-1MG
Uniprot ID Q9C098
Uniprot link http://www.uniprot.org/uniprot/Q9C098
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGSELDMGKGPMYDVEKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAANVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILI
Molecular weight 54.83kDa
Protein delivered with Tag? Yes
Purity estimated 30%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_208382.1
Spec:Entrez GeneID 85443
Spec:NCBI Gene Aliases DCAMKL3, DCDC3C, DCK3, CLR
Spec:SwissProtID Q9C098
NCBI Reference NP_208382.1
Aliases /Synonyms Human DCLK3 partial (162-632), doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3 ou Doublecortin domain-containing protein 3C ou Doublecortin-like and CAM kinase-like 3 ou Doublecortin-like kinase 3
Reference PX-P2075
Note For research use only
Molecular Constructor
Partial Yes

Human Human DCLK3 partial (162-632) Recombinant Protein

There are no reviews yet.

Be the first to review “Human Human DCLK3 partial (162-632) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products