Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human Leukocyte surface antigen CD47 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q08722
Molecular weight:
16.64kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human Leukocyte surface antigen CD47 recombinant protein

Human Leukocyte surface antigen CD47 recombinant protein

Product name Human Leukocyte surface antigen CD47 recombinant protein
Uniprot ID Q08722
Uniprot link http://www.uniprot.org/uniprot/Q08722
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEGSHHHHHH
Molecular weight 16.64kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 50mM Tris-HCl pH 7.0, 150mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD47, MER6, OA3, Antigen Identified By Monoclonal Antibody 1D8, Antigenic Surface Determinant Protein OA3, Rh-Related Antigen
Reference PX-P4008
Note For research use only
Molecular Constructor
Partial Yes
Product name Human Leukocyte surface antigen CD47 recombinant protein
Uniprot ID Q08722
Uniprot link http://www.uniprot.org/uniprot/Q08722
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNEGSHHHHHH
Molecular weight 16.64kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer 50mM Tris-HCl pH 7.0, 150mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Aliases /Synonyms CD47, MER6, OA3, Antigen Identified By Monoclonal Antibody 1D8, Antigenic Surface Determinant Protein OA3, Rh-Related Antigen
Reference PX-P4008
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human Leukocyte surface antigen CD47 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products