Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

  • ARO-A13321-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: $393.00.Current price is: $305.00.

50ug 22% OFF + 305 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

Product name ARO-A13321-100
Uniprot ID P04141
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Granulocyte-macrophage colony-stimulating factor, Sargramostim, GMCSF, CSF, Colony-stimulating factor, CSF2, GM-CSF, Molgramostin
Reference ARO-A13321
Clonality Monoclonal Antibody
Protein Name Granulocyte-macrophage colony-stimulating factor
Product name ARO-A13321-1MG
Uniprot ID P04141
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Granulocyte-macrophage colony-stimulating factor, Sargramostim, GMCSF, CSF, Colony-stimulating factor, CSF2, GM-CSF, Molgramostin
Reference ARO-A13321
Clonality Monoclonal Antibody
Protein Name Granulocyte-macrophage colony-stimulating factor
Product name ARO-A13321-50
Uniprot ID P04141
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Granulocyte-macrophage colony-stimulating factor, Sargramostim, GMCSF, CSF, Colony-stimulating factor, CSF2, GM-CSF, Molgramostin
Reference ARO-A13321
Clonality Monoclonal Antibody
Protein Name Granulocyte-macrophage colony-stimulating factor

Flow Cytometry results for InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

Flow Cytometry results for InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

Flow-cytometry using anti-human CSF2 antibody.CSF2 Transfected CHO cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human CSF2 antibody monoclonal antibody (Catalog # ARO-A13321 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

SDS-PAGE for InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

SEC-HPLC of InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053) was analyzed by size exclusion chromatography with UV detection.

Flow Cytometry results for InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

Flow Cytometry results for InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

Flow-cytometry using anti-human CSF2 antibody.Human peripheral blood lymphocytes were stained with an irrelevant antibody (Blue Histogram) or an anti-human CSF2 antibody monoclonal antibody (Catalog # ARO-A13321 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

Flow Cytometry results for InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)

Flow-cytometry using FITC anti-human CSF2 antibody. MDA-MB-231 cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human CSF2 monoclonal antibody (Catalog: ARO-A13321, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human CSF2/GM-CSF (Iv0053)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products