Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Human SNCA Antibody (Iv0173)

  • ARO-A13158-50
  • Validated WB
Clonality:
Monoclonal Antibody
Host species:
Mouse

Original price was: $384.00.Current price is: $305.00.

50ug 21% OFF + 305 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for InVivoMAb Anti-Human SNCA Antibody (Iv0173)
InVivoMAb Anti-Human SNCA Antibody (Iv0173) binds to Alpha-synuclein(SNCA) in WB Assay

InVivoMAb Anti-Human SNCA Antibody (Iv0173)

Product name ARO-A13158-100
Uniprot ID P37840
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-SNCA, Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid
Reference ARO-A13158
Clonality Monoclonal Antibody
Protein Name SNCA
Product name ARO-A13158-1MG
Uniprot ID P37840
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-SNCA, Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid
Reference ARO-A13158
Clonality Monoclonal Antibody
Protein Name SNCA
Product name ARO-A13158-50
Uniprot ID P37840
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-SNCA, Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid
Reference ARO-A13158
Clonality Monoclonal Antibody
Protein Name SNCA

SDS-PAGE for InVivoMAb Anti-Human SNCA Antibody (Iv0173)

SDS-PAGE for InVivoMAb Anti-Human SNCA Antibody (Iv0173)

InVivoMAb Anti-Human SNCA Antibody (Iv0173), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

InVivoMAb Anti-Human SNCA Antibody (Iv0173) binds to Alpha-synuclein(SNCA) in WB Assay

InVivoMAb Anti-Human SNCA Antibody (Iv0173) binds to Alpha-synuclein(SNCA) in WB Assay

Alpha-synuclein(SNCA)(cat. No.PX-P4717) can bind InVivoMAb Anti-Human SNCA Antibody (Iv0173) in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human SNCA Antibody (Iv0173)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products