Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Indenebart Biosimilar – Anti-Alpha-synuclein mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda2

Original price was: $217.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Indenebart Biosimilar - Anti-Alpha-synuclein mAb - Research Grade

Product name PX-TA2167-50
Uniprot ID P37840
Source CAS: 2864437-88-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2167-100
Note For research use only. Not suitable for human use.
Isotype IgG1, lambda2
Clonality Monoclonal Antibody
Product name Indenebart Biosimilar - Anti-Alpha-synuclein mAb - Research Grade
Uniprot ID P37840
Source CAS: 2864437-88-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2167-100
Note For research use only. Not suitable for human use.
Isotype IgG1, lambda2
Clonality Monoclonal Antibody
Product name Indenebart Biosimilar - Anti-Alpha-synuclein mAb - Research Grade
Uniprot ID P37840
Source CAS: 2864437-88-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Alpha-synuclein, PARK1, Non-A4 component of amyloid precursor, NACP, Non-A beta component of AD amyloid, SNCA
Reference PX-TA2167-100
Note For research use only. Not suitable for human use.
Isotype IgG1, lambda2
Clonality Monoclonal Antibody

Title: Introduction to Indenebart Biosimilar – Anti-Alpha-synuclein mAb

Indenebart Biosimilar – Anti-Alpha-synuclein mAb is a therapeutic antibody specifically designed to target alpha-synuclein, a protein that plays a key role in the development of neurodegenerative diseases such as Parkinson’s disease. This biosimilar is a promising new treatment option for patients suffering from these debilitating conditions.

Structure of Indenebart Biosimilar

Indenebart Biosimilar is a monoclonal antibody (mAb) that has been developed through a biosimilar approach. This means that it is highly similar to the reference product, but has been produced by a different manufacturer. The mAb is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions are responsible for binding to the target protein, while the constant regions are responsible for the antibody’s effector functions.

Activity of Indenebart Biosimilar

The primary activity of Indenebart Biosimilar is its ability to bind to alpha-synuclein with high specificity and affinity. This binding prevents the aggregation of alpha-synuclein, which is a key step in the development of neurodegenerative diseases. By inhibiting this aggregation, the biosimilar helps to reduce the toxic effects of alpha-synuclein and protect neurons from damage.

In addition to its direct binding activity, Indenebart Biosimilar also has effector functions that contribute to its therapeutic effects. These include antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which involve the recruitment of immune cells to target and destroy cells that are producing alpha-synuclein.

Therapeutic Target: Alpha-synuclein

Alpha-synuclein is a protein that is primarily found in the brain and is involved in the regulation of neurotransmitter release. In neurodegenerative diseases such as Parkinson’s, alpha-synuclein becomes misfolded and aggregates, forming toxic clumps that can damage neurons. This leads to the characteristic symptoms of these diseases, such as tremors and movement difficulties.

Indenebart Biosimilar specifically targets alpha-synuclein and prevents its aggregation, which is a key step in the progression of these diseases. By reducing the levels of toxic alpha-synuclein, the biosimilar helps to slow down the neurodegenerative process and improve symptoms.

Application of Indenebart Biosimilar

Indenebart Biosimilar is currently being investigated for its potential use in the treatment of Parkinson’s disease and other neurodegenerative disorders. It is being developed as a research grade product, which means that it is intended for use in preclinical and clinical studies to evaluate its safety and efficacy.

The biosimilar has shown promising results in animal models, with studies demonstrating its ability to reduce alpha-synuclein aggregation and improve motor function. Clinical trials are currently underway to further evaluate its safety and effectiveness in human patients.

Conclusion

Indenebart Biosimilar – Anti-Alpha-synuclein mAb is a novel therapeutic antibody that has been designed to target alpha-synuclein, a key protein involved in the development of neurodegenerative diseases. Its unique structure and activity make it a promising treatment option for patients suffering from these debilitating conditions. With ongoing research and clinical trials, Indenebart Biosimilar has the potential to improve the lives of those affected by Parkinson’s and other neurodegenerative disorders.

SDS-PAGE for Indenebart Biosimilar - Research Grade

SDS-PAGE for Indenebart Biosimilar - Research Grade

Indenebart Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Indenebart Biosimilar – Anti-Alpha-synuclein mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products