Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

ITGA4 recombinant protein

  • PX-P5178-50
  • Validated ELISA
Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P13612
Molecular weight:
33.20 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
His-tag Asn35–Leu315
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

ITGA4 recombinant protein

Product name PX-P5178-100
Uniprot ID P13612
Uniprot link https://www.uniprot.org/uniprot/P13612
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence NVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDL
Molecular weight 33.20 kDa
Protein delivered with Tag? N-terminal His-tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Leu315
Protein Accession P13612
Aliases /Synonyms VLA-4 Subunit Alpha ,CD49 Antigen-Like Family Member D,Integrin Subunit Alpha 4, CD49D
Reference PX-P5178
Note For research use only.
Molecular Constructor
His-tag Asn35–Leu315
Product name PX-P5178-1MG
Uniprot ID P13612
Uniprot link https://www.uniprot.org/uniprot/P13612
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence NVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDL
Molecular weight 33.20 kDa
Protein delivered with Tag? N-terminal His-tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Leu315
Protein Accession P13612
Aliases /Synonyms VLA-4 Subunit Alpha ,CD49 Antigen-Like Family Member D,Integrin Subunit Alpha 4, CD49D
Reference PX-P5178
Note For research use only.
Molecular Constructor
His-tag Asn35–Leu315
Product name PX-P5178-50
Uniprot ID P13612
Uniprot link https://www.uniprot.org/uniprot/P13612
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence NVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGSYFGASVCAVDL
Molecular weight 33.20 kDa
Protein delivered with Tag? N-terminal His-tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Leu315
Protein Accession P13612
Aliases /Synonyms VLA-4 Subunit Alpha ,CD49 Antigen-Like Family Member D,Integrin Subunit Alpha 4, CD49D
Reference PX-P5178
Note For research use only.
Molecular Constructor
His-tag Asn35–Leu315

Natalizumab Biosimilar - Anti-ITGA4, CD49d mAb - Research Grade binds to Human ITGA4 recombinant protein in indirect ELISA Assay

Natalizumab Biosimilar - Anti-ITGA4, CD49d mAb - Research Grade binds to Human ITGA4 recombinant protein in indirect ELISA Assay

Immobilized Human ITGA4 recombinant protein(cat. No.PX-P5178) at 4µg/mL (100µL/well) can bind to Natalizumab Biosimilar - Anti-ITGA4, CD49d mAb - Research Grade (cat. No.PX-TA1053) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

ITGA4 recombinant protein

There are no reviews yet.

Be the first to review “ITGA4 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products