Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ivonescimab Biosimilar – Anti-VEGF & PD1 mAb – Research Grade

  • PX-TA1763-50
  • Validated ELISA FC WB
Isotype:
IgG1-kappa-[scFv]2

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points

Ivonescimab Antibody for PD-1 and VEGF Research

Ivonescimab (AK112) antibody designed for immuno-oncology research targeting PD-1 and VEGF pathways. Research-grade biosimilar available at competitive cost.

Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ivonescimab Biosimilar - Anti-VEGF & PD1 mAb - Research Grade

Product name Ivonescimab Biosimilar - Anti-VEGF & PD1 mAb - Research Grade
Uniprot ID P15692 & Q15116
Source CAS: 2428381-53-5
Species Humanized
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ivonescimab,AK 112, AK-112, AK112,VEGF & PD1,anti-VEGF & PD1
Reference PX-TA1763
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa-[scFv]2
Clonality Monoclonal Antibody
Product name Ivonescimab Biosimilar - Anti-VEGF & PD1 mAb - Research Grade
Uniprot ID P15692 & Q15116
Source CAS: 2428381-53-5
Species Humanized
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ivonescimab,AK 112, AK-112, AK112,VEGF & PD1,anti-VEGF & PD1
Reference PX-TA1763
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa-[scFv]2
Clonality Monoclonal Antibody
Product name PX-TA1763-50
Uniprot ID P15692 & Q15116
Source CAS: 2428381-53-5
Species Humanized
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ivonescimab,AK 112, AK-112, AK112,VEGF & PD1,anti-VEGF & PD1
Reference PX-TA1763
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa-[scFv]2

What is Ivonescimab?

Ivonescimab (AK112) is an antibody developed to target both PD-1 and VEGF pathways, two key mechanisms involved in immune regulation and angiogenesis. It is widely studied in immuno-oncology research for its ability to modulate tumor immune responses while impacting vascular development.

Mechanism of Action

This ivonescimab antibody is used in research to explore combined inhibition of PD-1-mediated immune checkpoint signaling and VEGF-driven angiogenesis. Such dual pathway targeting is of particular interest in studies of tumor progression and therapeutic response.

Applications

  • Immuno-oncology research
  • PD-1 immune checkpoint studies
  • Angiogenesis and VEGF pathway analysis
  • Combination therapy research
  • Preclinical evaluation of antibody-based approaches

Key Features

  • Targets PD-1 and VEGF-related pathways
  • Suitable for advanced research applications
  • Consistent performance and reproducibility
  • Research-grade biosimilar format

About PD-1 and VEGF targeting

PD-1 is a key immune checkpoint receptor involved in regulating T-cell activity, while VEGF plays a central role in angiogenesis. Targeting both pathways is widely investigated in oncology research to better understand tumor immune evasion and vascular development.

Ivonescimab Antibody Price and Cost

The price of ivonescimab antibody depends on the required format, quantity, and research specifications. ProteoGenix provides high-quality biosimilars at competitive cost, ensuring accessibility for research applications.

For detailed pricing or bulk orders, you can request a quote directly from our team.

This product is available for fast delivery within the United States.

Need a tailored antibody solution?

If your research requires specific antibody formats or optimized targeting strategies, custom antibody development solutions can support advanced experimental needs.

Ivonescimab Biosimilar - Anti-VEGF &, PD1 mAb - Research Grade in ELISA Assay

Ivonescimab Biosimilar - Anti-VEGF &amp, PD1 mAb - Research Grade in ELISA Assay

Ivonescimab Biosimilar - Anti-VEGF &, PD1 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Flow Cytometry results for Ivonescimab Biosimilar - Anti-VEGF &, PD1 mAb - Research Grade

Flow Cytometry results for Ivonescimab Biosimilar - Anti-VEGF &amp, PD1 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Ivonescimab Biosimilar - Anti-VEGF &, PD1 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Ivonescimab Biosimilar - Anti-VEGF & PD1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Ivonescimab Biosimilar – Anti-VEGF & PD1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products