Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Motavizumab Biosimilar – Anti-RSV mAb – Research Grade

  • PX-TA1052-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $333.00.Current price is: $238.00.

100ug 29% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Motavizumab Biosimilar - Anti-RSV mAb - Research Grade

Product name Motavizumab Biosimilar - Anti-RSV mAb - Research Grade
Uniprot ID P03420
Source CAS 677010-34-3
Species Humanized
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Molecular weight 148kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Motavizumab,MEDI-524,RSV,anti-RSV
Reference PX-TA1052
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Motavizumab Biosimilar - Anti-RSV mAb - Research Grade
Uniprot ID P03420
Source CAS 677010-34-3
Species Humanized
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Molecular weight 148kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Motavizumab,MEDI-524,RSV,anti-RSV
Reference PX-TA1052
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1052-50
Uniprot ID P03420
Source CAS 677010-34-3
Species Humanized
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Molecular weight 148kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Motavizumab,MEDI-524,RSV,anti-RSV
Reference PX-TA1052
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Motavizumab Biosimilar, also known as Anti-RSV mAb, is a monoclonal antibody that targets the respiratory syncytial virus (RSV). It is a research grade antibody that has shown promising results in pre-clinical studies and has the potential to be used as a therapeutic agent against RSV infections. In this article, we will discuss the structure, activity, and potential applications of Motavizumab Biosimilar in detail.

Structure of Motavizumab Biosimilar

Motavizumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable region of the antibody is responsible for binding to the RSV virus, while the constant region mediates effector functions such as complement activation and antibody-dependent cellular cytotoxicity.

The unique feature of Motavizumab Biosimilar is its high affinity for the RSV fusion (F) protein, which is essential for the virus to enter and infect host cells. This high affinity is achieved through the incorporation of specific mutations in the antibody’s variable region, making it a potent inhibitor of RSV infection.

Activity of Motavizumab Biosimilar

Motavizumab Biosimilar works by binding to the RSV F protein, preventing the virus from entering and infecting host cells. This action not only inhibits viral replication but also reduces the severity of the infection. In pre-clinical studies, it has been shown to reduce viral load and lung inflammation in animal models of RSV infection.

In addition to its direct antiviral activity, Motavizumab Biosimilar also has immunomodulatory effects. It can enhance the activity of immune cells, such as natural killer cells and macrophages, to clear the virus from the body. This dual mechanism of action makes it a promising candidate for the treatment of RSV infections.

Potential Applications of Motavizumab Biosimilar

The main application of Motavizumab Biosimilar is in the treatment of RSV infections. RSV is a common respiratory virus that can cause severe illness, especially in young children, older adults, and people with weakened immune systems. Currently, there is no specific treatment for RSV, and the available options are limited to supportive care. Motavizumab Biosimilar has the potential to be a targeted and effective therapy for RSV infections, reducing the burden on healthcare systems and improving patient outcomes.

Moreover, Motavizumab Biosimilar can also be used for prophylaxis against RSV infections. In high-risk populations, such as premature infants and immunocompromised individuals, administration of the antibody can prevent RSV infection and its complications. This can be particularly beneficial during RSV outbreaks, which occur every year during the winter season.

Aside from its use in RSV infections, Motavizumab Biosimilar has also shown potential in other respiratory infections, such as influenza and parainfluenza. These viruses share similarities with RSV, and the antibody’s mechanism of action may be effective against them as well. Further research is needed to explore its potential in these areas.

Conclusion

Motavizumab Biosimilar is a promising research grade antibody that has the potential to be used as a therapeutic agent against RSV infections. Its unique structure and high affinity for the RSV F protein make it a potent inhibitor of viral infection. In addition to its direct antiviral activity, it also has immunomodulatory effects, making it a dual-action therapy for RSV. With its potential to improve patient outcomes and reduce the burden on healthcare systems, Motavizumab Biosimilar holds great promise in the fight against RSV.

Keywords: antibody, therapeutic target, RSV, respiratory syncytial

Motavizumab Biosimilar - Anti-RSV mAb - Research Grade in ELISA Assay

Motavizumab Biosimilar - Anti-RSV mAb - Research Grade in ELISA Assay

Motavizumab Biosimilar - Anti-RSV mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Motavizumab Biosimilar - Anti-RSV mAb - Research Grade

SDS-PAGE for Motavizumab Biosimilar - Anti-RSV mAb - Research Grade

Motavizumab Biosimilar - Anti-RSV mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Motavizumab Biosimilar - Anti-RSV mAb - Research Grade

There are no reviews yet.

Be the first to review “Motavizumab Biosimilar – Anti-RSV mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products