Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse CD47 recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q61735-2
Molecular weight:
18.88 kDa

Original price was: $526.00.Current price is: $470.00.

100ug 11% OFF + 470 loyalty points
Met1–Ile162 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Mouse CD47 recombinant protein
Mouse CD47 recombinant protein

Mouse CD47 recombinant protein

Product name PX-P6437-100
Uniprot ID Q61735-2
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPNEKI
Molecular weight 18.88 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ile162
Aliases /Synonyms Integrin-associated protein, IAP, CD47, Cd47Leukocyte surface antigen CD47,
Reference PX-P6437
Molecular Constructor
Met1–Ile162 His
Product name PX-P6437-1MG
Uniprot ID Q61735-2
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPNEKI
Molecular weight 18.88 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ile162
Aliases /Synonyms Integrin-associated protein, IAP, CD47, Cd47Leukocyte surface antigen CD47,
Reference PX-P6437
Molecular Constructor
Met1–Ile162 His
Product name PX-P6437-50
Uniprot ID Q61735-2
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPNEKI
Molecular weight 18.88 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ile162
Aliases /Synonyms Integrin-associated protein, IAP, CD47, Cd47Leukocyte surface antigen CD47,
Reference PX-P6437
Molecular Constructor
Met1–Ile162 His

SDS-PAGE for Mouse CD47 recombinant protein

SDS-PAGE for Mouse CD47 recombinant protein

Mouse CD47 recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Mouse CD47 recombinant protein

There are no reviews yet.

Be the first to review “Mouse CD47 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products