Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse SHH Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q62226
Molecular weight:
47.91 kDa

Original price was: $339.00.Current price is: $271.00.

50ug 20% OFF + 271 loyalty points
Cys25–Gly198 Fc
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse SHH Recombinant Protein, C-Fc

Mouse SHH Recombinant Protein, C-Fc

Product name ARO-P20602-100
Uniprot ID Q62226
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Molecular weight 47.91 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys25-Gly198
Aliases /Synonyms EC:3.1.-.-, HHG-1, SHH, Shh N-terminal processed signaling domains, Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains, ShhN, ShhNC, ShhNp, Sonic hedgehog protein, Sonic hedgehog protein N-product
Reference ARO-P20602
Note For research use only.
Molecular Constructor
Cys25–Gly198 Fc
Product name ARO-P20602-1MG
Uniprot ID Q62226
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Molecular weight 47.91 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys25-Gly198
Aliases /Synonyms EC:3.1.-.-, HHG-1, SHH, Shh N-terminal processed signaling domains, Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains, ShhN, ShhNC, ShhNp, Sonic hedgehog protein, Sonic hedgehog protein N-product
Reference ARO-P20602
Note For research use only.
Molecular Constructor
Cys25–Gly198 Fc
Product name ARO-P20602-50
Uniprot ID Q62226
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Molecular weight 47.91 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys25-Gly198
Aliases /Synonyms EC:3.1.-.-, HHG-1, SHH, Shh N-terminal processed signaling domains, Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains, ShhN, ShhNC, ShhNp, Sonic hedgehog protein, Sonic hedgehog protein N-product
Reference ARO-P20602
Note For research use only.
Molecular Constructor
Cys25–Gly198 Fc

There are no reviews yet.

Be the first to review “Mouse SHH Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products