Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Muzastotug Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA1950-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $233.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Muzastotug Biosimilar - Anti-CD152 mAb - Research Grade

Product name Muzastotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2750031-18-4
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1950
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Muzastotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2750031-18-4
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1950
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1950-50
Uniprot ID P16410
Source CAS: 2750031-18-4
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1950
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Muzastotug Biosimilar – Anti-CD152 mAb – Research Grade: A Revolutionary Antibody for Targeted Therapy Muzastotug Biosimilar is a novel monoclonal antibody (mAb) that specifically targets CD152, a protein found on the surface of immune cells. This biosimilar is a highly effective and safe therapeutic option for a variety of diseases, making it a promising breakthrough in the field of targeted therapy.

Structure of Muzastotug Biosimilar

Muzastotug Biosimilar is a recombinant humanized IgG1 antibody, meaning it is derived from human genetic material and has been modified to reduce potential immunogenicity. It is composed of two heavy chains and two light chains, each with a specific amino acid sequence that gives the antibody its unique structure.

The variable region of Muzastotug Biosimilar is responsible for its specificity towards CD152, while the constant region is responsible for its effector functions. The antibody also contains a hinge region that allows for flexibility and binding to its target.

Activity of Muzastotug Biosimilar

Muzastotug Biosimilar works by binding to CD152 on the surface of immune cells, specifically T lymphocytes. This binding inhibits the activity of CD152, which is a co-inhibitory receptor that plays a crucial role in regulating immune responses.

By blocking CD152, Muzastotug Biosimilar enhances the activity of T cells, leading to a stronger and more effective immune response against diseased cells. This makes it a valuable tool in the treatment of various diseases, including cancer, autoimmune disorders, and infectious diseases.

Application of Muzastotug Biosimilar

Muzastotug Biosimilar is currently being studied for its potential therapeutic applications in a variety of diseases. In oncology, it has shown promising results in combination with other cancer treatments, such as chemotherapy and immunotherapy, by enhancing the body’s natural defense mechanisms against cancer cells.

In autoimmune disorders, Muzastotug Biosimilar has shown great potential in treating diseases such as rheumatoid arthritis, multiple sclerosis, and psoriasis. By modulating the immune response, it can help reduce inflammation and improve symptoms in these conditions.

Additionally, Muzastotug Biosimilar is being investigated for its potential in treating infectious diseases, such as HIV and hepatitis B. By boosting the immune system, it can help the body fight off these viruses and prevent their replication.

Conclusion

Muzastotug Biosimilar is a revolutionary antibody that specifically targets CD152, a protein involved in regulating immune responses. Its unique structure and mechanism of action make it a highly effective and safe therapeutic option for a variety of diseases. With ongoing research and clinical trials, Muzastotug Biosimilar has the potential to significantly improve the treatment outcomes for patients in need of targeted therapy.

Research Grade Muzastotug binds to Mouse CD152 recombinant protein in ELISA Assay

Research Grade Muzastotug binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Research Grade Muzastotug in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Muzastotug

SDS-PAGE for Research Grade Muzastotug

Research Grade Muzastotug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Muzastotug Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Muzastotug Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products