Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Galsulfase Biosimilar – G4S – Research Grade

Uniprot ID:
P15848

Original price was: $286.00.Current price is: $238.00.

100ug 17% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Galsulfase Biosimilar - G4S - Research Grade

Product name Galsulfase Biosimilar - G4S - Research Grade
Uniprot ID P15848
Raw Antigen Sequence MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-G4S,ASB,N-acetylgalactosamine-4-sulfatase,ARSB,Arylsulfatase B,
Reference PX-TA1909
Note For research use only. Not suitable for clinical or therapeutic use.
Product name Galsulfase Biosimilar - G4S - Research Grade
Uniprot ID P15848
Raw Antigen Sequence MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-G4S,ASB,N-acetylgalactosamine-4-sulfatase,ARSB,Arylsulfatase B,
Reference PX-TA1909
Note For research use only. Not suitable for clinical or therapeutic use.
Product name PX-TA1909-50
Uniprot ID P15848
Raw Antigen Sequence MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-G4S,ASB,N-acetylgalactosamine-4-sulfatase,ARSB,Arylsulfatase B,
Reference PX-TA1909
Note For research use only. Not suitable for clinical or therapeutic use.

Introduction

Galsulfase Biosimilar – G4S – Research Grade, also known as idursulfase, is a recombinant form of the enzyme iduronate-2-sulfatase (IDS). This biosimilar is used in the treatment of mucopolysaccharidosis type II (MPS II), also known as Hunter syndrome. MPS II is a rare genetic disorder caused by a deficiency in the IDS enzyme, leading to the accumulation of glycosaminoglycans (GAGs) in various tissues and organs. G4S is a therapeutic antibody that specifically targets the deficiency of IDS, providing a promising treatment option for patients with MPS II.

Structure of Galsulfase Biosimilar – G4S

G4S is a biosimilar of the enzyme IDS, which is normally produced by the body to break down GAGs. G4S is produced through recombinant DNA technology, where the gene for IDS is inserted into a host cell, such as Chinese hamster ovary cells. The resulting protein is then purified and formulated into a therapeutic antibody. G4S has a similar structure to the natural IDS enzyme, with a molecular weight of approximately 80 kDa. It is a glycoprotein with a single polypeptide chain of 628 amino acids, containing both N-linked and O-linked glycosylation sites. The structure of G4S allows it to specifically target and bind to the deficient IDS enzyme, restoring its function and reducing the accumulation of GAGs.

Activity of Galsulfase Biosimilar – G4S

G4S works by replacing the missing or deficient IDS enzyme in patients with MPS II. The enzyme IDS is responsible for breaking down GAGs, which are long chains of sugar molecules found in the body. In patients with MPS II, the deficiency of IDS leads to the buildup of GAGs in various tissues and organs, causing a range of symptoms such as skeletal abnormalities, respiratory problems, and neurological impairment. G4S binds to the deficient IDS enzyme, allowing it to break down the accumulated GAGs and prevent further buildup. This helps to alleviate the symptoms of MPS II and improve the overall quality of life for patients.

Applications of Galsulfase Biosimilar – G4S

G4S is currently approved for the treatment of MPS II in many countries, including the United States, Europe, and Japan. It is indicated for use in both children and adults with MPS II. G4S is administered through intravenous infusion, typically once a week. The recommended dosage is based on the patient’s weight, with a maximum dose of 1 mg/kg. G4S has shown significant clinical efficacy in reducing the accumulation of GAGs and improving the overall symptoms of MPS II. It has also been well-tolerated by patients, with minimal side effects reported.

Future Developments and Research

While G4S has shown promising results in the treatment of MPS II, there is still ongoing research and development in this area. Researchers are exploring the potential of G4S in combination with other therapies, such as gene therapy, to further improve its efficacy. Additionally, there is ongoing research to develop more convenient and less invasive routes of administration for G4S, such as subcutaneous injection. Further studies are also being conducted to evaluate the long-term safety and efficacy of G4S in patients with MPS II.

Conclusion

Galsulfase Biosimilar – G4S – Research Grade is a recombinant form of the enzyme IDS, used in the treatment of MPS II. It has a similar structure to the natural IDS enzyme and works by replacing the deficient enzyme and breaking down the accumulated GAGs. G4S has shown significant clinical efficacy and has been well-tolerated by patients. Ongoing research and development in this area will continue to improve the treatment options for patients with MPS II.

SDS-PAGE for Naglazyme;Galsulfase Biosimilar - Anti-ARSB mAb - Research Grade

SDS-PAGE for Naglazyme;Galsulfase Biosimilar - Anti-ARSB mAb - Research Grade

Naglazyme;Galsulfase Biosimilar - Anti-ARSB mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Galsulfase Biosimilar - G4S - Research Grade

There are no reviews yet.

Be the first to review “Galsulfase Biosimilar – G4S – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products