Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Opugotamig Biosimilar – Anti-Folate receptor alpha;FBP mAb – Research Grade

  • PX-TA2206-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
Ig (G1_L-kappa)_scFvkh-G1(h-CH2-CH3)

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Opugotamig Biosimilar - Anti-Folate receptor alpha;FBP mAb - Research Grade

Product name PX-TA2206-50
Uniprot ID P15328
Source Biparatopic, Bivalent, CAS: 2779564-38-2
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2206-100
Note For research use only. Not suitable for human use.
Isotype Ig (G1_L-kappa)_scFvkh-G1(h-CH2-CH3)
Clonality Monoclonal Antibody
Product name Opugotamig Biosimilar - Anti-Folate receptor alpha;FBP mAb - Research Grade
Uniprot ID P15328
Source Biparatopic, Bivalent, CAS: 2779564-38-2
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2206-100
Note For research use only. Not suitable for human use.
Isotype Ig (G1_L-kappa)_scFvkh-G1(h-CH2-CH3)
Clonality Monoclonal Antibody
Product name Opugotamig Biosimilar - Anti-Folate receptor alpha;FBP mAb - Research Grade
Uniprot ID P15328
Source Biparatopic, Bivalent, CAS: 2779564-38-2
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Folate receptor alpha, FOLR, FOLR1, Adult folate-binding protein, Folate receptor 1, FR-alpha, KB cells FBP, FBP, Ovarian tumor-associated antigen MOv18, Folate receptor, adult
Reference PX-TA2206-100
Note For research use only. Not suitable for human use.
Isotype Ig (G1_L-kappa)_scFvkh-G1(h-CH2-CH3)
Clonality Monoclonal Antibody

Introduction

Opugotamig Biosimilar – Anti-Folate receptor alpha;FBP mAb – Research Grade is a therapeutic antibody that targets the folate receptor alpha (FRA), also known as folate binding protein (FBP). This biosimilar is designed to mimic the activity of the original therapeutic antibody, providing a cost-effective and accessible treatment option for patients.

Structure of Opugotamig Biosimilar

Opugotamig Biosimilar is a monoclonal antibody (mAb) that is produced through recombinant DNA technology. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains contain a constant region and a variable region, while the light chains only have a variable region. The variable regions of the heavy and light chains come together to form the antigen-binding site, which is responsible for binding to the target FRA.

Activity of Opugotamig Biosimilar

Opugotamig Biosimilar works by specifically targeting and binding to the FRA on the surface of cancer cells. This binding triggers a series of events that lead to the destruction of the cancer cells. The first step is internalization, where the antibody and the bound FRA are taken inside the cell. This is followed by the release of toxic substances, such as cytotoxic drugs or radioactive particles, which can kill the cancer cells. Additionally, Opugotamig Biosimilar can also activate the immune system to attack the cancer cells, known as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Application of Opugotamig Biosimilar

Opugotamig Biosimilar is primarily used for the treatment of cancer, specifically cancers that overexpress FRA, such as ovarian, lung, and breast cancer. By targeting the FRA, Opugotamig Biosimilar can specifically attack cancer cells while sparing healthy cells, reducing side effects and improving patient outcomes. It can be used alone or in combination with other cancer treatments, such as chemotherapy or radiation therapy.

Therapeutic Antibody

Opugotamig Biosimilar is classified as a therapeutic antibody, which is a type of antibody that is designed to treat diseases. Unlike diagnostic antibodies, which are used to detect and identify specific molecules, therapeutic antibodies are used to directly target and treat diseases. They can be used to block the activity of harmful molecules, activate the immune system, or deliver toxic substances to specific cells.

Therapeutic Target: Folate Receptor Alpha

Folate receptor alpha (FRA) is a protein that is overexpressed on the surface of many cancer cells, making it an ideal therapeutic target. FRA is involved in the transport of folate, a type of vitamin, into cells for essential cellular processes. However, in cancer cells, FRA is overexpressed and plays a role in promoting cell growth and survival. By targeting FRA, Opugotamig Biosimilar can disrupt these processes and lead to the destruction of cancer cells.

Conclusion

Opugotamig Biosimilar – Anti-Folate receptor alpha;FBP mAb – Research Grade is a promising therapeutic antibody that targets FRA, a protein that is overexpressed on the surface of many cancer cells. Its structure and activity allow it to specifically target and destroy cancer cells, making it an effective and targeted treatment option. With its potential to improve patient outcomes and reduce treatment costs, Opugotamig Biosimilar has the potential to make a significant impact in the field of cancer treatment.

SDS-PAGE for Opugotamig Biosimilar - Research Grade

SDS-PAGE for Opugotamig Biosimilar - Research Grade

Opugotamig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Opugotamig Biosimilar - Research Grade in ELISA Assay

Opugotamig Biosimilar - Research Grade in ELISA Assay

Opugotamig Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Opugotamig Biosimilar – Anti-Folate receptor alpha;FBP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products