Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Orilanolimab Biosimilar – Anti-FCGRT mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Orilanolimab Biosimilar - Anti-FCGRT mAb - Research Grade

Product name Orilanolimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Source CAS 2066544-85-0
Species Chimeric
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Orilanolimab,SYNT-001,FCGRT,anti-FCGRT
Reference PX-TA1531
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Orilanolimab Biosimilar - Anti-FCGRT mAb - Research Grade
Uniprot ID P55899
Source CAS 2066544-85-0
Species Chimeric
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Orilanolimab,SYNT-001,FCGRT,anti-FCGRT
Reference PX-TA1531
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1531-50
Uniprot ID P55899
Source CAS 2066544-85-0
Species Chimeric
Raw Antigen Sequence MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Orilanolimab,SYNT-001,FCGRT,anti-FCGRT
Reference PX-TA1531
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Orilanolimab Biosimilar, also known as Anti-FCGRT mAb, is a monoclonal antibody that has shown promising results in the treatment of various diseases. This biosimilar is a research grade drug that has the potential to target a specific therapeutic target and provide effective treatment options for patients. In this article, we will discuss the structure, activity, and application of Orilanolimab Biosimilar in detail.

Structure of Orilanolimab Biosimilar

Orilanolimab Biosimilar is a humanized monoclonal antibody that is composed of two heavy chains and two light chains. The heavy chains are made up of four constant regions (Fc) and one variable region (VH), while the light chains consist of two constant regions (CL) and one variable region (VL). The variable regions of both heavy and light chains are responsible for binding to the target antigen, while the constant regions provide stability and effector functions.

The amino acid sequence of Orilanolimab Biosimilar is highly similar to the reference product, making it a suitable alternative for therapeutic use. The drug is produced using recombinant DNA technology, where the gene for the antibody is inserted into a host cell, and the protein is then expressed and purified.

Activity of Orilanolimab Biosimilar

Orilanolimab Biosimilar works by targeting the neonatal Fc receptor (FcRn), which is responsible for the recycling and maintenance of immunoglobulin G (IgG) in the body. This receptor is found in various tissues, including the liver, kidney, and placenta, and plays a crucial role in the immune system.

By binding to FcRn, Orilanolimab Biosimilar blocks the recycling of IgG, leading to a decrease in its levels in the body. This, in turn, reduces the levels of autoantibodies and inflammatory cytokines, which are responsible for various diseases. Additionally, the drug also has a direct effect on immune cells, leading to the suppression of immune responses and inflammation.

Application of Orilanolimab Biosimilar

Orilanolimab Biosimilar has shown promising results in the treatment of various diseases, including autoimmune disorders, inflammatory conditions, and cancer. It has been studied in preclinical and clinical trials, and has shown to be safe and effective in reducing disease activity and improving patient outcomes.

In autoimmune disorders, Orilanolimab Biosimilar has been shown to decrease the levels of autoantibodies and reduce disease activity in conditions such as rheumatoid arthritis, systemic lupus erythematosus, and myasthenia gravis. It has also been studied in inflammatory conditions like psoriasis, Crohn’s disease, and ulcerative colitis, where it has shown to reduce inflammation and improve symptoms.

In cancer, Orilanolimab Biosimilar has been investigated as a potential immunotherapy agent. By targeting FcRn, it can enhance the activity of immune cells, such as natural killer cells and macrophages, leading to the destruction of cancer cells. It has shown promising results in preclinical studies and is currently being evaluated in clinical trials for various types of cancer.

Conclusion

In conclusion, Orilanolimab Biosimilar, also known as Anti-FCGRT mAb, is a research grade monoclonal antibody that has the potential to target a specific therapeutic target and provide effective treatment options for patients. Its structure, activity, and application make it a promising drug for the treatment of various diseases. Further research and clinical trials are needed to fully understand the potential of this biosimilar and its role in improving patient outcomes.

SDS-PAGE for Orilanolimab Biosimilar - Anti-FCGRT;FCRN mAb - Research Grade

SDS-PAGE for Orilanolimab Biosimilar - Anti-FCGRT;FCRN mAb - Research Grade

Orilanolimab Biosimilar - Anti-FCGRT;FCRN mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Orilanolimab Biosimilar - Anti-FCGRT mAb - Research Grade

There are no reviews yet.

Be the first to review “Orilanolimab Biosimilar – Anti-FCGRT mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products