Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iratumumab Biosimilar – Anti-TNFRSF8, CD30 mAb – Research Grade

  • PX-TA1178-100UG
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $307.00.Current price is: $238.00.

100ug 22% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Iratumumab Biosimilar - Anti-TNFRSF8, CD30 mAb - Research Grade

Product name Iratumumab Biosimilar - Anti-TNFRSF8, CD30 mAb - Research Grade
Uniprot ID P28908
Source CAS 640735-09-7
Species Homo sapiens
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Iratumumab,MDX-060,TNFRSF8, CD30,anti-TNFRSF8, CD30
Reference PX-TA1178
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Iratumumab Biosimilar - Anti-TNFRSF8, CD30 mAb - Research Grade
Uniprot ID P28908
Source CAS 640735-09-7
Species Homo sapiens
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Iratumumab,MDX-060,TNFRSF8, CD30,anti-TNFRSF8, CD30
Reference PX-TA1178
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1178-50
Uniprot ID P28908
Source CAS 640735-09-7
Species Homo sapiens
Raw Antigen Sequence MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Iratumumab,MDX-060,TNFRSF8, CD30,anti-TNFRSF8, CD30
Reference PX-TA1178
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Iratumumab Biosimilar is a monoclonal antibody (mAb) that targets TNFRSF8, also known as CD30, a protein found on the surface of certain immune cells. This biosimilar is a research grade version of the original Iratumumab, which is a therapeutic antibody used in the treatment of certain types of cancer. In this article, we will delve into the structure, activity, and potential applications of Iratumumab Biosimilar as an antibody targeting CD30.

Structure of Iratumumab Biosimilar

Iratumumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody, meaning it is derived from human and mouse sources. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the CD30 protein, while the constant region plays a role in the immune response and half-life of the antibody.

The variable region of Iratumumab Biosimilar is engineered to have a high affinity for CD30, allowing it to specifically target and bind to this protein. This targeting is crucial as CD30 is overexpressed in certain types of cancer cells, making it a promising therapeutic target.

Activity of Iratumumab Biosimilar

The primary mechanism of action of Iratumumab Biosimilar is through its binding to CD30. Once bound, it can trigger various immune responses, including antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These processes involve the recruitment and activation of immune cells, such as natural killer cells and macrophages, to target and eliminate CD30-expressing cancer cells.

In addition, Iratumumab Biosimilar can also induce apoptosis (programmed cell death) in CD30-positive cancer cells. This is achieved through the activation of specific signaling pathways within the cancer cells, leading to their death.

Applications of Iratumumab Biosimilar

As mentioned earlier, Iratumumab Biosimilar is a research grade version of the original therapeutic antibody. This means that it is primarily used for research purposes, such as in vitro and in vivo studies to understand the role of CD30 in cancer and to evaluate the efficacy and safety of the antibody.

However, there is also potential for Iratumumab Biosimilar to be developed as a therapeutic antibody for the treatment of CD30-positive cancers. Currently, the original Iratumumab is approved for use in the treatment of Hodgkin lymphoma and anaplastic large cell lymphoma. As a biosimilar, Iratumumab Biosimilar has the potential to offer a more affordable and accessible treatment option for these and other CD30-positive cancers.

Conclusion

In summary, Iratumumab Biosimilar is a research grade monoclonal antibody that targets CD30, a protein overexpressed in certain types of cancer cells. Its structure allows for specific binding to CD30, while its activity involves triggering immune responses and inducing apoptosis in cancer cells. While currently used primarily for research purposes, there is potential for Iratumumab Biosimilar to be developed as a therapeutic antibody for the treatment of CD30-positive cancers.

Flow Cytometry results for Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade

Flow Cytometry results for Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade

Flow Cytometry results for Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Iratumumab Biosimilar - Anti-TNFRSF8; CD30 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Iratumumab Biosimilar - Anti-TNFRSF8, CD30 mAb - Research Grade

There are no reviews yet.

Be the first to review “Iratumumab Biosimilar – Anti-TNFRSF8, CD30 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products