Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rainbow trout rtCD64s Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Rainbow trout
Molecular weight:
34.74 kDa

Original price was: $280.00.Current price is: $250.00.

50ug 11% OFF + 250 loyalty points
Unknown Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Rainbow trout rtCD64s Recombinant Protein

Product name Rainbow trout rtCD64s Recombinant Protein
Origin species Rainbow trout
Expression system Prokaryotic expression
Raw Antigen Sequence QVLPTSAPQTAVAELVKGLPWIFSGESVHLKCSVPGNVSAEWRYRWFRGGEQLQESEYFVLWKARPQQSGKYYCRGLRTTWINTQHTLHSLPIEIEVDGGWAILQAPPLPMLVGETMTLTCRVRNNPKLTEVILYKDGVELQIQRGPELRVTNLTLQHHGSYWCRASWDGRRETNSVISVAAPVSIVEVLTEPMLEIVPNDPLIHKDRMLLVCHVQLNARQPVPHIHYYFYQDGLSLGPASSQDKITVLRDSGQYWCKASVPTLGLKRLSKPLGYGRVTGEPSEHLRMRNQKIIVVPLGSHHHHHH
Molecular weight 34.74 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS pH 7.5 +urea 8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Aliases /Synonyms rtCD64s
Reference PX-P3064
Note For research use only
Molecular Constructor
Unknown Yes
Product name Rainbow trout rtCD64s Recombinant Protein
Origin species Rainbow trout
Expression system Prokaryotic expression
Raw Antigen Sequence QVLPTSAPQTAVAELVKGLPWIFSGESVHLKCSVPGNVSAEWRYRWFRGGEQLQESEYFVLWKARPQQSGKYYCRGLRTTWINTQHTLHSLPIEIEVDGGWAILQAPPLPMLVGETMTLTCRVRNNPKLTEVILYKDGVELQIQRGPELRVTNLTLQHHGSYWCRASWDGRRETNSVISVAAPVSIVEVLTEPMLEIVPNDPLIHKDRMLLVCHVQLNARQPVPHIHYYFYQDGLSLGPASSQDKITVLRDSGQYWCKASVPTLGLKRLSKPLGYGRVTGEPSEHLRMRNQKIIVVPLGSHHHHHH
Molecular weight 34.74 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS pH 7.5 +urea 8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Aliases /Synonyms rtCD64s
Reference PX-P3064
Note For research use only
Molecular Constructor
Unknown Yes
Product name PX-P3064-1MG
Origin species Rainbow trout
Expression system Prokaryotic expression
Raw Antigen Sequence QVLPTSAPQTAVAELVKGLPWIFSGESVHLKCSVPGNVSAEWRYRWFRGGEQLQESEYFVLWKARPQQSGKYYCRGLRTTWINTQHTLHSLPIEIEVDGGWAILQAPPLPMLVGETMTLTCRVRNNPKLTEVILYKDGVELQIQRGPELRVTNLTLQHHGSYWCRASWDGRRETNSVISVAAPVSIVEVLTEPMLEIVPNDPLIHKDRMLLVCHVQLNARQPVPHIHYYFYQDGLSLGPASSQDKITVLRDSGQYWCKASVPTLGLKRLSKPLGYGRVTGEPSEHLRMRNQKIIVVPLGSHHHHHH
Molecular weight 34.74 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS pH 7.5 +urea 8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Aliases /Synonyms rtCD64s
Reference PX-P3064
Note For research use only
Molecular Constructor
Unknown Yes

Rainbow trout rtCD64s Recombinant Protein

There are no reviews yet.

Be the first to review “Rainbow trout rtCD64s Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products