Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Brucella suis omp19 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Brucella suis biovar 1 (strain 1330)
Uniprot ID:
P0A3P2
Molecular weight:
38.06 kDa

Original price was: $331.00.Current price is: $274.00.

50ug 17% OFF + 274 loyalty points
Pro80–Arg177
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Brucella suis omp19 Protein, N-GST & C-His

Product name ARO-P10242-100
Uniprot ID P0A3P2
Origin species Brucella suis biovar 1 (strain 1330)
Expression system Prokaryotic expression
Raw Antigen Sequence PPASAPDLTPGAVAGVWNASLGGQSCKIATPQTKYGQGYRAGPLRCPGELANLASWAVNGKQLVLYDANGGTVASLYSSGQGRFDGQTTGGQAVTLSR
Molecular weight 38.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro80-Arg177
Aliases /Synonyms Outer membrane lipoprotein omp19, 18 kDa immunoreactive antigen, 19 kDa OMP, Minor outer membrane protein omp19, omp19, BR1930, BS1330_I1924
Reference ARO-P10242
Note For research use only.
Molecular Constructor
Pro80–Arg177
Product name ARO-P10242-1MG
Uniprot ID P0A3P2
Origin species Brucella suis biovar 1 (strain 1330)
Expression system Prokaryotic expression
Raw Antigen Sequence PPASAPDLTPGAVAGVWNASLGGQSCKIATPQTKYGQGYRAGPLRCPGELANLASWAVNGKQLVLYDANGGTVASLYSSGQGRFDGQTTGGQAVTLSR
Molecular weight 38.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro80-Arg177
Aliases /Synonyms Outer membrane lipoprotein omp19, 18 kDa immunoreactive antigen, 19 kDa OMP, Minor outer membrane protein omp19, omp19, BR1930, BS1330_I1924
Reference ARO-P10242
Note For research use only.
Molecular Constructor
Pro80–Arg177
Product name ARO-P10242-50
Uniprot ID P0A3P2
Origin species Brucella suis biovar 1 (strain 1330)
Expression system Prokaryotic expression
Raw Antigen Sequence PPASAPDLTPGAVAGVWNASLGGQSCKIATPQTKYGQGYRAGPLRCPGELANLASWAVNGKQLVLYDANGGTVASLYSSGQGRFDGQTTGGQAVTLSR
Molecular weight 38.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro80-Arg177
Aliases /Synonyms Outer membrane lipoprotein omp19, 18 kDa immunoreactive antigen, 19 kDa OMP, Minor outer membrane protein omp19, omp19, BR1930, BS1330_I1924
Reference ARO-P10242
Note For research use only.
Molecular Constructor
Pro80–Arg177

There are no reviews yet.

Be the first to review “Recombinant Brucella suis omp19 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products