Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant EEEV Spike glycoprotein E2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Eastern equine encephalitis virus (EEEV) (Eastern equine encephalomyelitis virus)
Uniprot ID:
P08768
Molecular weight:
42.72 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Asp323–Arg681
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant EEEV Spike glycoprotein E2 Protein, N-His

Product name ARO-P10287-100
Uniprot ID P08768
Origin species Eastern equine encephalitis virus (EEEV) (Eastern equine encephalomyelitis virus)
Expression system Prokaryotic expression
Raw Antigen Sequence DLDTHFTQYKLARPYIADCPNCGHSRCDSPIAIEEVRGDAHAGVIRIQTSAMFGLKRHGVDLAYMSFMNGKTQKSIKIDNLHVRTSAPCSLVSHHGYYILAQCPPGDTVTVGFHDGPNRHTCRLAHKVEFRPVGREKYRHPPEHGVELPCNRYTHKRADQGHYVEMHQPGLVGDHSLLSIHSAKVKITVPSGAQVKYYCKCPDVREGITSSDHTTTCTDVKQCRAYLIDNKKWVYNSGRLPRGEGDTFKGKLHVPFVPVKAKCIATLAPEPLVEHKHRTLILHLHPDHPTLLTTRSLGSDANPTRQWIERPTTVNFTVTGEGLEYTWGNHPPKRVWAQESGEGNPHGWPHVVVVYYYNR
Molecular weight 42.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp323-Arg681
Aliases /Synonyms Structural polyprotein, p130, Capsid protein, 3.4.21.90, Coat protein, C, Precursor of protein E3/E2, p62, pE2, Assembly protein E3, Spike glycoprotein E2, E2 envelope glycoprotein, 6K protein, Spike glycoprotein E1, E1 envelope glycoprotein
Reference ARO-P10287
Note For research use only.
Molecular Constructor
Asp323–Arg681
Product name ARO-P10287-1MG
Uniprot ID P08768
Origin species Eastern equine encephalitis virus (EEEV) (Eastern equine encephalomyelitis virus)
Expression system Prokaryotic expression
Raw Antigen Sequence DLDTHFTQYKLARPYIADCPNCGHSRCDSPIAIEEVRGDAHAGVIRIQTSAMFGLKRHGVDLAYMSFMNGKTQKSIKIDNLHVRTSAPCSLVSHHGYYILAQCPPGDTVTVGFHDGPNRHTCRLAHKVEFRPVGREKYRHPPEHGVELPCNRYTHKRADQGHYVEMHQPGLVGDHSLLSIHSAKVKITVPSGAQVKYYCKCPDVREGITSSDHTTTCTDVKQCRAYLIDNKKWVYNSGRLPRGEGDTFKGKLHVPFVPVKAKCIATLAPEPLVEHKHRTLILHLHPDHPTLLTTRSLGSDANPTRQWIERPTTVNFTVTGEGLEYTWGNHPPKRVWAQESGEGNPHGWPHVVVVYYYNR
Molecular weight 42.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp323-Arg681
Aliases /Synonyms Structural polyprotein, p130, Capsid protein, 3.4.21.90, Coat protein, C, Precursor of protein E3/E2, p62, pE2, Assembly protein E3, Spike glycoprotein E2, E2 envelope glycoprotein, 6K protein, Spike glycoprotein E1, E1 envelope glycoprotein
Reference ARO-P10287
Note For research use only.
Molecular Constructor
Asp323–Arg681
Product name ARO-P10287-50
Uniprot ID P08768
Origin species Eastern equine encephalitis virus (EEEV) (Eastern equine encephalomyelitis virus)
Expression system Prokaryotic expression
Raw Antigen Sequence DLDTHFTQYKLARPYIADCPNCGHSRCDSPIAIEEVRGDAHAGVIRIQTSAMFGLKRHGVDLAYMSFMNGKTQKSIKIDNLHVRTSAPCSLVSHHGYYILAQCPPGDTVTVGFHDGPNRHTCRLAHKVEFRPVGREKYRHPPEHGVELPCNRYTHKRADQGHYVEMHQPGLVGDHSLLSIHSAKVKITVPSGAQVKYYCKCPDVREGITSSDHTTTCTDVKQCRAYLIDNKKWVYNSGRLPRGEGDTFKGKLHVPFVPVKAKCIATLAPEPLVEHKHRTLILHLHPDHPTLLTTRSLGSDANPTRQWIERPTTVNFTVTGEGLEYTWGNHPPKRVWAQESGEGNPHGWPHVVVVYYYNR
Molecular weight 42.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp323-Arg681
Aliases /Synonyms Structural polyprotein, p130, Capsid protein, 3.4.21.90, Coat protein, C, Precursor of protein E3/E2, p62, pE2, Assembly protein E3, Spike glycoprotein E2, E2 envelope glycoprotein, 6K protein, Spike glycoprotein E1, E1 envelope glycoprotein
Reference ARO-P10287
Note For research use only.
Molecular Constructor
Asp323–Arg681

Recombinant EEEV Spike Glycoprotein E2 Protein, N-His: Structure, Activity, and Applications

Introduction to Eastern Equine Encephalitis Virus (EEEV)

Eastern Equine Encephalitis Virus (EEEV) is a highly pathogenic alphavirus that causes severe and often fatal encephalitis in humans and horses. The virus is transmitted by mosquitoes and has a high mortality rate, particularly in humans. Despite its lethality, there are currently no effective vaccines or treatments available, making the development of targeted therapeutic strategies crucial. The spike glycoprotein E2, a key viral component, is a major focus of research due to its central role in the viral life cycle and potential as a therapeutic target.

Structure of EEEV Spike Glycoprotein E2

The EEEV spike glycoprotein E2 is a critical element of the viral envelope, involved in the initial stages of infection. Structurally, E2 is a membrane-bound glycoprotein that interacts with the host cell surface receptors, facilitating the virus’s entry into the cell. The E2 protein forms a heterodimer with the E1 glycoprotein, with E2 primarily responsible for receptor binding and E1 mediating membrane fusion. The extracellular domain of E2 contains several antigenic sites, making it a prime target for neutralizing antibodies and therapeutic interventions.

Recombinant EEEV Spike Glycoprotein E2 Protein, N-His: Characteristics and Structure

The Recombinant EEEV Spike Glycoprotein E2 Protein, N-His is a laboratory-produced version of the native E2 protein, engineered to include an N-terminal His-tag for ease of purification and detection. This recombinant protein retains the functional and structural integrity of the natural E2 glycoprotein, including its receptor-binding domains. The His-tagged version allows for efficient purification using nickel affinity chromatography, making it highly suitable for use in various experimental applications. The recombinant nature of this protein ensures consistency and high purity, which are critical for reliable research outcomes.

Activity of Recombinant EEEV Spike Glycoprotein E2 Protein

The Recombinant EEEV Spike Glycoprotein E2 Protein, N-His is functionally active and capable of mimicking the native E2 protein’s interaction with host cell receptors. This recombinant protein is instrumental in studying the binding affinity and specificity of the E2 protein to its target receptors, which is a crucial step in the viral infection process. By replicating the receptor-binding activity of the native E2 protein, this recombinant version serves as a valuable tool in research focused on understanding the molecular mechanisms of EEEV entry into host cells and identifying potential therapeutic inhibitors.

Applications of Recombinant EEEV Spike Glycoprotein E2 Protein, N-His

Research Applications: The Recombinant EEEV Spike Glycoprotein E2 Protein, N-His is widely used in research to study the pathogenesis of Eastern Equine Encephalitis. Researchers utilize this protein to investigate the mechanisms of virus-host interactions, specifically the binding of E2 to host cell receptors. It is also employed in high-throughput screening assays to identify small molecules or antibodies that can block the E2-mediated entry of the virus, which is essential for developing antiviral therapies. Therapeutic Potential: Given its pivotal role in viral entry, the E2 glycoprotein is considered a promising therapeutic target. The Recombinant EEEV Spike Glycoprotein E2 Protein, N-His is used in the development of vaccines and therapeutic antibodies aimed at neutralizing the virus by inhibiting the interaction between E2 and host cell receptors. By blocking this critical step, potential therapeutic agents can prevent the virus from infecting cells, thereby reducing the severity of the disease or preventing it altogether. Diagnostic Applications: In addition to its research and therapeutic uses, this recombinant E2 protein can be utilized in diagnostic assays. For instance, it can be used as an antigen in ELISA tests to detect the presence of antibodies against EEEV in patient sera. This application is crucial for early detection and monitoring of EEEV infections, particularly in outbreak situations.

Conclusion

The Recombinant EEEV Spike Glycoprotein E2 Protein, N-His is a vital tool in the study and treatment of Eastern Equine Encephalitis Virus. Its applications in research, therapeutic development, and diagnostics make it an essential component in efforts to combat this highly lethal virus. By targeting the E2 glycoprotein, researchers can develop more effective interventions, potentially leading to new therapies and vaccines that can significantly reduce the impact of EEEV.

There are no reviews yet.

Be the first to review “Recombinant EEEV Spike glycoprotein E2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products