Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AFAP1L2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N4X5
Molecular weight:
17.30 kDa

Original price was: $255.00.Current price is: $230.00.

50ug 10% OFF + 230 loyalty points
Glu355–Glu485
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AFAP1L2 Protein, N-His

Product name ARO-P11174-100
Uniprot ID Q8N4X5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHKGEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSE
Molecular weight 17.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu355-Glu485
Aliases /Synonyms KIAA1914, AFAP1-like protein 2, Actin filament-associated protein 1-like 2, AFAP1L2, XB130
Reference ARO-P11174
Note For research use only.
Molecular Constructor
Glu355–Glu485
Product name ARO-P11174-1MG
Uniprot ID Q8N4X5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHKGEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSE
Molecular weight 17.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu355-Glu485
Aliases /Synonyms KIAA1914, AFAP1-like protein 2, Actin filament-associated protein 1-like 2, AFAP1L2, XB130
Reference ARO-P11174
Note For research use only.
Molecular Constructor
Glu355–Glu485
Product name ARO-P11174-50
Uniprot ID Q8N4X5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHKGEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSE
Molecular weight 17.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu355-Glu485
Aliases /Synonyms KIAA1914, AFAP1-like protein 2, Actin filament-associated protein 1-like 2, AFAP1L2, XB130
Reference ARO-P11174
Note For research use only.
Molecular Constructor
Glu355–Glu485

Introduction

Recombinant Human AFAP1L2 Protein, also known as AFAP1L2, is a protein that is encoded by the AFAP1L2 gene. This protein belongs to the AFAP family and is involved in cellular signaling pathways and cytoskeletal organization. Recombinant AFAP1L2 protein is produced through genetic engineering techniques and has various applications in the fields of molecular biology, biochemistry, and medicine.

Structure of Recombinant Human AFAP1L2 Protein

The AFAP1L2 protein is a member of the actin filament-associated protein (AFAP) family, which is involved in the regulation of actin cytoskeleton dynamics. The protein is composed of 676 amino acids and has a molecular weight of approximately 75 kDa. It contains multiple domains, including an N-terminal F-actin binding domain, a central proline-rich region, and a C-terminal Src homology 3 (SH3) domain. These domains are essential for the protein’s function in cytoskeletal organization and signaling pathways.

Activity of Recombinant Human AFAP1L2 Protein

The main function of AFAP1L2 protein is to regulate the assembly and disassembly of actin filaments, which are crucial for cellular processes such as cell migration, adhesion, and division. The F-actin binding domain of AFAP1L2 allows it to bind to actin filaments and regulate their dynamics. Additionally, the proline-rich region of the protein interacts with other proteins, including the tyrosine kinase c-Abl, to modulate signaling pathways involved in cell growth and survival.

Moreover, AFAP1L2 has been shown to play a role in the regulation of the Wnt/β-catenin signaling pathway, which is essential for embryonic development and tissue homeostasis. This suggests that the protein may have a role in cell differentiation and tissue regeneration.

Applications of Recombinant Human AFAP1L2 Protein

Recombinant AFAP1L2 protein has various applications in the fields of molecular biology, biochemistry, and medicine. It can be used in in vitro studies to investigate the protein’s function and interactions with other molecules. The F-actin binding domain of AFAP1L2 can be used to study the dynamics of actin filaments and their role in cellular processes.

Additionally, AFAP1L2 protein has been identified as a potential biomarker for certain cancers, including breast cancer and prostate cancer. It has also been shown to be overexpressed in certain types of leukemia, making it a potential therapeutic target for these diseases. Recombinant AFAP1L2 protein can be used in research to understand the mechanisms of cancer development and to develop targeted therapies.

Furthermore, AFAP1L2 has been linked to neurological disorders such as Alzheimer’s disease and schizophrenia. Recombinant AFAP1L2 protein can be used to study the protein’s role in these disorders and potentially develop new treatments.

Conclusion

In conclusion, Recombinant Human AFAP1L2 Protein is a multifunctional protein that plays a critical role in cytoskeletal organization and signaling pathways. Its structure and activity make it a valuable tool for studying cellular processes and diseases. With its potential applications in cancer research and neurological disorders, AFAP1L2 protein holds great promise for future scientific discoveries and medical advancements.

Recombinant Human AFAP1L2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AFAP1L2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products