Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PER2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O15055
Molecular weight:
37.04 kDa

Original price was: $278.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Ser172–Pro475
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PER2 Protein, N-His

Product name ARO-P12423-100
Uniprot ID O15055
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTVEEMESVTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFHSFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRDQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVP
Molecular weight 37.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Pro475
Aliases /Synonyms Circadian clock protein PERIOD 2, KIAA0347, Period circadian protein homolog 2, PER2, hPER2
Reference ARO-P12423
Note For research use only.
Molecular Constructor
Ser172–Pro475
Product name ARO-P12423-1MG
Uniprot ID O15055
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTVEEMESVTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFHSFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRDQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVP
Molecular weight 37.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Pro475
Aliases /Synonyms Circadian clock protein PERIOD 2, KIAA0347, Period circadian protein homolog 2, PER2, hPER2
Reference ARO-P12423
Note For research use only.
Molecular Constructor
Ser172–Pro475
Product name ARO-P12423-50
Uniprot ID O15055
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTVEEMESVTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFHSFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRDQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVP
Molecular weight 37.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser172-Pro475
Aliases /Synonyms Circadian clock protein PERIOD 2, KIAA0347, Period circadian protein homolog 2, PER2, hPER2
Reference ARO-P12423
Note For research use only.
Molecular Constructor
Ser172–Pro475

Introduction to Recombinant Human PER2 Protein

Recombinant Human PER2 Protein is a highly specialized and important protein that plays a crucial role in the regulation of circadian rhythms in humans. It is a synthetic version of the PER2 protein, which is naturally produced in the human body. This recombinant protein is widely used in scientific research and has various applications in the field of chronobiology and circadian rhythm disorders.

Structure of Recombinant Human PER2 Protein

Recombinant Human PER2 Protein is a 130 kDa protein that consists of 1182 amino acids. It is composed of several functional domains, including the PAS domain, the PER-ARNT-SIM (PAS) domain, and the C-terminal domain. These domains are essential for the proper functioning of the protein and are responsible for its interactions with other proteins and molecules.

The PAS domain is responsible for sensing and responding to environmental cues, such as light and temperature, which are crucial for regulating circadian rhythms. The PER-ARNT-SIM domain is involved in protein-protein interactions and helps in the formation of protein complexes. The C-terminal domain is responsible for the stability and degradation of the protein.

Activity of Recombinant Human PER2 Protein

Recombinant Human PER2 Protein plays a crucial role in the regulation of circadian rhythms, which are the daily physiological and behavioral patterns that follow a 24-hour cycle. It is involved in the negative feedback loop of the circadian clock, which is responsible for maintaining the 24-hour rhythm of biological processes.

The activity of Recombinant Human PER2 Protein is regulated by post-translational modifications, such as phosphorylation and acetylation. These modifications affect the stability and function of the protein and play a crucial role in regulating its activity.

Applications of Recombinant Human PER2 Protein

Recombinant Human PER2 Protein has various applications in scientific research, particularly in the field of chronobiology and circadian rhythm disorders. Some of its key applications include:

1. Study of circadian rhythms

Recombinant Human PER2 Protein is widely used in the study of circadian rhythms and the molecular mechanisms that regulate them. Its ability to interact with other proteins and molecules makes it an essential tool for understanding the complex processes involved in maintaining the 24-hour biological clock.

2. Development of chronobiology-based therapies

The dysregulation of circadian rhythms has been linked to various health conditions, such as sleep disorders, metabolic disorders, and mental health disorders. Recombinant Human PER2 Protein is being studied for its potential in the development of chronobiology-based therapies for these conditions.

3. Diagnosis of circadian rhythm disorders

Recombinant Human PER2 Protein can also be used as an antigen in diagnostic tests for circadian rhythm disorders. Its specific interactions with other proteins and molecules make it a reliable marker for the dysregulation of circadian rhythms.

4. Drug development

Recombinant Human PER2 Protein is also being studied for its potential in drug development. Its involvement in the negative feedback loop of the circadian clock makes it a potential target for the development of drugs that can regulate circadian rhythms and treat related disorders.

5. Biotechnology applications

Recombinant Human PER2 Protein has also found applications in biotechnology, particularly in the development of genetically modified organisms (GMOs). Its ability to regulate circadian rhythms in plants has been studied for its potential in improving crop yield and plant growth.

Conclusion

In conclusion, Recombinant Human PER2 Protein is a highly specialized and important protein that plays a crucial role in regulating circadian rhythms in humans. Its structure, activity, and various applications make it a valuable tool in scientific research and have the potential to contribute to the development of therapies for circadian rhythm disorders.

Recombinant Human PER2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PER2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products