Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ALG13 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NP73
Molecular weight:
16.17 kDa

Original price was: $387.00.Current price is: $327.00.

100ug 16% OFF + 327 loyalty points
Met1–Thr126
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ALG13 Protein, N-His

Product name ARO-P10673-100
Uniprot ID Q9NP73
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCT
Molecular weight 16.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr126
Aliases /Synonyms CXorf45, GLT28D1, Asparagine-linked glycosylation 13 homolog, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13, ALG13, Glycosyltransferase 28 domain-containing protein 1
Reference ARO-P10673
Note For research use only.
Molecular Constructor
Met1–Thr126
Product name ARO-P10673-1MG
Uniprot ID Q9NP73
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCT
Molecular weight 16.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr126
Aliases /Synonyms CXorf45, GLT28D1, Asparagine-linked glycosylation 13 homolog, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13, ALG13, Glycosyltransferase 28 domain-containing protein 1
Reference ARO-P10673
Note For research use only.
Molecular Constructor
Met1–Thr126
Product name ARO-P10673-50
Uniprot ID Q9NP73
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCT
Molecular weight 16.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Thr126
Aliases /Synonyms CXorf45, GLT28D1, Asparagine-linked glycosylation 13 homolog, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13, ALG13, Glycosyltransferase 28 domain-containing protein 1
Reference ARO-P10673
Note For research use only.
Molecular Constructor
Met1–Thr126

Introduction

Recombinant Human ALG13 Protein, also known as Alpha-1,3-glucosyltransferase ALG13, is a glycosyltransferase enzyme that plays a crucial role in the biosynthesis of N-linked glycoproteins. It is encoded by the ALG13 gene and is highly conserved among eukaryotic organisms. Recombinant Human ALG13 Protein is widely used in various research fields, such as glycobiology, cell biology, and biotechnology, due to its unique structure and diverse functions.

Structure of Recombinant Human ALG13 Protein

Recombinant Human ALG13 Protein is a type II transmembrane protein that consists of 382 amino acids. It has a molecular weight of approximately 43 kDa and is composed of multiple structural domains. The N-terminus of the protein contains a cytoplasmic domain, followed by a transmembrane domain, and a large luminal domain. The luminal domain of Recombinant Human ALG13 Protein has a conserved catalytic domain, which is responsible for its enzymatic activity.

Enzymatic Activity of Recombinant Human ALG13 Protein

Recombinant Human ALG13 Protein is a glycosyltransferase enzyme that catalyzes the transfer of glucose from UDP-glucose to the growing oligosaccharide chain of N-linked glycoproteins. This enzymatic activity is essential for the proper folding and function of glycoproteins, which are involved in a wide range of biological processes, including cell signaling, immune response, and protein trafficking.

The enzymatic activity of Recombinant Human ALG13 Protein is dependent on its interaction with other proteins, such as ALG14 and ALG2, which form a complex known as the ALG13/ALG14/ALG2 complex. This complex acts as a heterodimeric glycosyltransferase and plays a crucial role in the biosynthesis of N-linked glycoproteins.

Applications of Recombinant Human ALG13 Protein

Recombinant Human ALG13 Protein has a wide range of applications in various research fields. One of its major applications is in the study of glycobiology, where it is used to investigate the biosynthesis and function of N-linked glycoproteins. It is also used in cell biology studies to understand the role of glycosylation in cellular processes, such as protein folding, trafficking, and signaling.

In addition, Recombinant Human ALG13 Protein is used in biotechnology for the production of glycoprotein-based therapeutics. Its enzymatic activity is utilized in the in vitro glycosylation of recombinant proteins, which can improve their stability, solubility, and efficacy. This makes Recombinant Human ALG13 Protein a valuable tool for the development of novel glycoprotein-based drugs.

Furthermore, Recombinant Human ALG13 Protein has potential applications in the diagnosis and treatment of certain diseases. Mutations in the ALG13 gene have been linked to various disorders, such as congenital disorders of glycosylation and intellectual disabilities. Recombinant Human ALG13 Protein can be used to study these diseases and potentially develop targeted therapies.

Conclusion

In summary, Recombinant Human ALG13 Protein is a crucial enzyme that plays a vital role in the biosynthesis of N-linked glycoproteins. Its unique structure and enzymatic activity make it a valuable tool for studying glycobiology, cell biology, and biotechnology. With its potential applications in drug development and disease research, Recombinant Human ALG13 Protein continues to be an important protein in the scientific community.

Recombinant Human ALG13 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ALG13 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products