Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAB4A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P20338
Molecular weight:
21.53 kDa

Original price was: $466.00.Current price is: $392.00.

100ug 16% OFF + 392 loyalty points
Asp11–Gly181
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAB4A Protein, N-His

Product name ARO-P11595-100
Uniprot ID P20338
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESG
Molecular weight 21.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp11-Gly181
Aliases /Synonyms Ras-related protein Rab-4A, RAB4A, RAB4
Reference ARO-P11595
Note For research use only.
Molecular Constructor
Asp11–Gly181
Product name ARO-P11595-1MG
Uniprot ID P20338
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESG
Molecular weight 21.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp11-Gly181
Aliases /Synonyms Ras-related protein Rab-4A, RAB4A, RAB4
Reference ARO-P11595
Note For research use only.
Molecular Constructor
Asp11–Gly181
Product name ARO-P11595-50
Uniprot ID P20338
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESG
Molecular weight 21.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp11-Gly181
Aliases /Synonyms Ras-related protein Rab-4A, RAB4A, RAB4
Reference ARO-P11595
Note For research use only.
Molecular Constructor
Asp11–Gly181

Introduction

Recombinant proteins, also known as r-proteins, are proteins that are produced in a laboratory using genetic engineering techniques. These proteins have become essential tools in various fields of research, diagnostics, and therapeutics. One such protein is the Recombinant Human RAB4A Protein, which has gained significant attention due to its unique structure, activity, and potential applications.

Structure of Recombinant Human RAB4A Protein

The Recombinant Human RAB4A Protein is a member of the RAS oncogene family, which plays a crucial role in regulating vesicular trafficking in eukaryotic cells. This protein is encoded by the RAB4A gene, located on chromosome 1 in humans. The protein has a molecular weight of 25 kDa and consists of 211 amino acids. It has a highly conserved GTP-binding domain and a C-terminal hypervariable region, which are essential for its activity.

The crystal structure of Recombinant Human RAB4A Protein has been determined, revealing its unique three-dimensional conformation. The protein has a globular shape, with six alpha-helices and six beta-sheets, forming a central core. The GTP-binding domain is located in the center of the protein, while the hypervariable region is exposed on the surface. This structure allows the protein to interact with other molecules and perform its functions.

Activity of Recombinant Human RAB4A Protein

The main function of Recombinant Human RAB4A Protein is to regulate the trafficking of proteins and lipids between different compartments of the cell. It is primarily involved in the recycling of endocytic vesicles, which are responsible for transporting molecules from the cell surface to the interior of the cell. The GTP-binding domain of the protein acts as a molecular switch, cycling between its active GTP-bound form and its inactive GDP-bound form. This switch controls the protein’s ability to interact with other molecules and regulate vesicular trafficking.

Recombinant Human RAB4A Protein also plays a crucial role in the maintenance of cell polarity and the formation of tight junctions between cells. It is involved in the transport of specific proteins to the cell membrane, where they are essential for cell adhesion and communication. Additionally, the protein has been shown to regulate the activity of various signaling pathways, including the MAPK and PI3K pathways, which are important for cell growth and survival.

Applications of Recombinant Human RAB4A Protein

The unique structure and activity of Recombinant Human RAB4A Protein make it a valuable tool in various research areas. It has been extensively used in studies related to vesicular trafficking, cell polarity, and cell signaling. The protein has also been implicated in various diseases, including cancer, neurodegenerative disorders, and infectious diseases. Therefore, it has become a potential target for drug development.

In addition to research, Recombinant Human RAB4A Protein has potential diagnostic and therapeutic applications. It can be used as an antigen in immunoassays to detect the presence of specific antibodies in patient samples. This can aid in the diagnosis of diseases associated with RAB4A dysfunction. Furthermore, the protein can be used as a target for drug delivery systems, where it can specifically target cells with high RAB4A expression, such as cancer cells.

Conclusion

In summary, Recombinant Human RAB4A Protein is a unique protein with a crucial role in regulating vesicular trafficking and cell signaling. Its structure, activity, and potential applications make it an essential tool in various fields of research, diagnostics, and therapeutics. Further studies on this protein are necessary to fully understand its functions and potential as a target for disease treatment.

</

Recombinant Human RAB4A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RAB4A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products