Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARCN1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P48444
Molecular weight:
29.18 kDa

Original price was: $422.00.Current price is: $327.00.

100ug 23% OFF + 327 loyalty points
Ser273–Leu511
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARCN1 Protein, N-His

Product name ARO-P11794-100
Uniprot ID P48444
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEIL
Molecular weight 29.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser273-Leu511
Aliases /Synonyms Delta-coat protein, Coatomer subunit delta, COPD, ARCN1, Archain, Delta-COP
Reference ARO-P11794
Note For research use only.
Molecular Constructor
Ser273–Leu511
Product name ARO-P11794-1MG
Uniprot ID P48444
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEIL
Molecular weight 29.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser273-Leu511
Aliases /Synonyms Delta-coat protein, Coatomer subunit delta, COPD, ARCN1, Archain, Delta-COP
Reference ARO-P11794
Note For research use only.
Molecular Constructor
Ser273–Leu511
Product name ARO-P11794-50
Uniprot ID P48444
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEIL
Molecular weight 29.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser273-Leu511
Aliases /Synonyms Delta-coat protein, Coatomer subunit delta, COPD, ARCN1, Archain, Delta-COP
Reference ARO-P11794
Note For research use only.
Molecular Constructor
Ser273–Leu511

Introduction

Recombinant Human ARCN1 Protein, also known as Archain 1, is a protein that plays a crucial role in protein trafficking and vesicular transport. It is a subunit of the coat protein complex I (COPI), which is responsible for the formation of vesicles that transport proteins from the Golgi apparatus to the endoplasmic reticulum (ER) and between different compartments within the cell. Recombinant Human ARCN1 Protein is produced through genetic engineering techniques and has various applications in research and biotechnology.

Structure of Recombinant Human ARCN1 Protein

Recombinant Human ARCN1 Protein is composed of 194 amino acids and has a molecular weight of 21.5 kDa. It is a highly conserved protein, with a 96% sequence identity among different species. The protein contains a coiled-coil domain and a beta-barrel domain, which are essential for its function in COPI vesicle formation. It also has two N-glycosylation sites, which are important for protein stability and proper folding.

Activity of Recombinant Human ARCN1 Protein

Recombinant Human ARCN1 Protein is a key component of the COPI complex, which is involved in the retrograde transport of proteins from the Golgi apparatus to the ER. This protein interacts with other subunits of the COPI complex, such as ARCN2 and ARCN3, to form a stable complex. It also interacts with other proteins, such as ADP-ribosylation factor 1 (ARF1), to regulate the formation and function of COPI vesicles.

The activity of Recombinant Human ARCN1 Protein is essential for maintaining the proper functioning of the secretory pathway in cells. It is involved in the sorting and packaging of cargo proteins into COPI vesicles, which are then transported to their respective destinations. This protein also plays a role in the retrieval of ER resident proteins that have been mistakenly transported to the Golgi apparatus.

Application of Recombinant Human ARCN1 Protein

Recombinant Human ARCN1 Protein has various applications in research and biotechnology. It is commonly used as an antigen in studies related to COPI vesicle formation and intracellular protein trafficking. It can also be used as a molecular tool to investigate the function of COPI complex subunits and their interactions with other proteins.

Furthermore, Recombinant Human ARCN1 Protein has potential therapeutic applications. Mutations in the gene encoding this protein have been associated with various diseases, such as osteogenesis imperfecta and congenital disorder of glycosylation type IIg. Therefore, understanding the structure and function of this protein can aid in the development of treatments for these diseases.

In addition, Recombinant Human ARCN1 Protein has been used in the production of biologics, such as vaccines and therapeutic proteins. It can be expressed in various expression systems, such as bacteria, yeast, and mammalian cells, to produce large quantities of the protein for commercial use.

Conclusion

In conclusion, Recombinant Human ARCN1 Protein is a crucial component of the COPI complex, which plays a vital role in protein trafficking and vesicular transport within cells. Its structure and activity have been extensively studied, and it has various applications in research and biotechnology. With its potential therapeutic applications and use in the production of biologics, Recombinant Human ARCN1 Protein continues to be an important protein in the scientific community.

Recombinant Human ARCN1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARCN1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products