Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ATP1B2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P14415
Molecular weight:
26.14 kDa

Original price was: $278.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Gly81–Thr290
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ATP1B2 Protein, N-His

Product name ARO-P11857-100
Uniprot ID P14415
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
Molecular weight 26.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly81-Thr290
Aliases /Synonyms ATP1B2, Adhesion molecule in glia, Sodium/potassium-transporting ATPase subunit beta-2, Sodium/potassium-dependent ATPase subunit beta-2, AMOG
Reference ARO-P11857
Note For research use only.
Molecular Constructor
Gly81–Thr290
Product name ARO-P11857-1MG
Uniprot ID P14415
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
Molecular weight 26.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly81-Thr290
Aliases /Synonyms ATP1B2, Adhesion molecule in glia, Sodium/potassium-transporting ATPase subunit beta-2, Sodium/potassium-dependent ATPase subunit beta-2, AMOG
Reference ARO-P11857
Note For research use only.
Molecular Constructor
Gly81–Thr290
Product name ARO-P11857-50
Uniprot ID P14415
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
Molecular weight 26.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly81-Thr290
Aliases /Synonyms ATP1B2, Adhesion molecule in glia, Sodium/potassium-transporting ATPase subunit beta-2, Sodium/potassium-dependent ATPase subunit beta-2, AMOG
Reference ARO-P11857
Note For research use only.
Molecular Constructor
Gly81–Thr290

Structure of Recombinant Human ATP1B2 Protein

Recombinant Human ATP1B2 Protein is a type of protein that is produced through genetic engineering techniques. It is a recombinant protein, meaning that it is created by combining DNA sequences from different sources. The ATP1B2 gene, which codes for this protein, is isolated from human cells and inserted into a host cell, such as bacteria or yeast, to produce large quantities of the protein.

The recombinant human ATP1B2 protein is composed of 303 amino acids and has a molecular weight of approximately 33 kDa. It belongs to the type II transmembrane protein family and is a subunit of the Na+/K+ ATPase enzyme. This enzyme is responsible for maintaining the balance of sodium and potassium ions in cells, which is crucial for various cellular processes.

The primary structure of the recombinant human ATP1B2 protein consists of a short cytoplasmic N-terminal domain, a transmembrane domain, and a longer cytoplasmic C-terminal domain. The transmembrane domain is composed of four alpha helices that span the cell membrane, while the cytoplasmic domains are involved in protein-protein interactions and regulation of enzyme activity.

Activity of Recombinant Human ATP1B2 Protein

The main function of the recombinant human ATP1B2 protein is to act as a regulatory subunit of the Na+/K+ ATPase enzyme. It binds to the alpha subunit of the enzyme and helps in its proper folding and assembly. This, in turn, enhances the activity of the enzyme in transporting sodium and potassium ions across the cell membrane.

In addition to its role in regulating the activity of the Na+/K+ ATPase enzyme, the recombinant human ATP1B2 protein also plays a crucial role in maintaining the electrical potential of cells. It helps in establishing and maintaining the membrane potential, which is essential for various cellular processes such as nerve impulse transmission, muscle contraction, and nutrient uptake.

Moreover, the recombinant human ATP1B2 protein has been found to interact with other proteins involved in cell signaling pathways and cell cycle regulation. It has also been linked to cell proliferation and differentiation, making it a potential target for cancer therapy.

Application of Recombinant Human ATP1B2 Protein

The recombinant human ATP1B2 protein has various applications in both research and therapeutic settings. Due to its role in regulating the Na+/K+ ATPase enzyme, it is widely used in studies related to ion transport and membrane potential. It is also used in drug discovery and development, as compounds that target the Na+/K+ ATPase enzyme can potentially modulate the activity of the recombinant human ATP1B2 protein.

Furthermore, the recombinant human ATP1B2 protein has shown promising results in cancer research. Studies have shown that it is overexpressed in certain types of cancer, and targeting this protein can potentially inhibit tumor growth and progression. It is also being investigated as a potential biomarker for cancer diagnosis and prognosis.

In addition, the recombinant human ATP1B2 protein has potential therapeutic applications in conditions such as hypertension, heart failure, and neurological disorders. As it plays a crucial role in regulating membrane potential, targeting this protein can potentially help in the treatment of these diseases.

Conclusion

In summary, the recombinant human ATP1B2 protein is a crucial regulatory subunit of the Na+/K+ ATPase enzyme, involved in maintaining the balance of sodium and potassium ions in cells. Its structure, activity, and various applications make it a valuable protein in both research and therapeutic settings. Further studies on this protein can

Recombinant Human ATP1B2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ATP1B2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products