Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD257/TNFSF13B, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y275
Molecular weight:
21.42 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
Lys113–Lys283
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD257/TNFSF13B, N-His

Product name ARO-P12796-100
Uniprot ID Q9Y275
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALK
Molecular weight 21.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys113-Lys283
Aliases /Synonyms BAFF, ZTNF4, BLYS, Tumor necrosis factor ligand superfamily member 13B, Dendritic cell-derived TNF-like molecule, TALL-1, TNF- and APOL-related leukocyte expressed ligand 1, BLyS, B lymphocyte stimulator, TNFSF13B, CD257, TNFSF20, TALL1, B-cell-activating factor, Drug Target
Reference ARO-P12796
Note For research use only.
Molecular Constructor
Lys113–Lys283
Product name ARO-P12796-1MG
Uniprot ID Q9Y275
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALK
Molecular weight 21.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys113-Lys283
Aliases /Synonyms BAFF, ZTNF4, BLYS, Tumor necrosis factor ligand superfamily member 13B, Dendritic cell-derived TNF-like molecule, TALL-1, TNF- and APOL-related leukocyte expressed ligand 1, BLyS, B lymphocyte stimulator, TNFSF13B, CD257, TNFSF20, TALL1, B-cell-activating factor, Drug Target
Reference ARO-P12796
Note For research use only.
Molecular Constructor
Lys113–Lys283
Product name ARO-P12796-50
Uniprot ID Q9Y275
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALK
Molecular weight 21.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys113-Lys283
Aliases /Synonyms BAFF, ZTNF4, BLYS, Tumor necrosis factor ligand superfamily member 13B, Dendritic cell-derived TNF-like molecule, TALL-1, TNF- and APOL-related leukocyte expressed ligand 1, BLyS, B lymphocyte stimulator, TNFSF13B, CD257, TNFSF20, TALL1, B-cell-activating factor, Drug Target
Reference ARO-P12796
Note For research use only.
Molecular Constructor
Lys113–Lys283

The Structure of Recombinant Human CD257/TNFSF13B

Recombinant Human CD257/TNFSF13B, also known as B cell activating factor (BAFF), is a protein that plays a crucial role in the immune system. It is a member of the tumor necrosis factor (TNF) superfamily and is primarily produced by immune cells such as monocytes, macrophages, and dendritic cells. The recombinant protein is produced through genetic engineering techniques, where the gene encoding for CD257/TNFSF13B is inserted into a host cell, typically a bacterial or mammalian cell, to produce large quantities of the protein.

The protein has a molecular weight of approximately 32 kDa and is composed of 285 amino acids. It has a similar structure to other TNF family members, with a single transmembrane domain and a C-terminal extracellular domain. The extracellular domain is responsible for binding to its receptor, BAFF-R, which is expressed on B cells, T cells, and dendritic cells. The binding of CD257/TNFSF13B to its receptor triggers a signaling cascade that promotes B cell survival, proliferation, and differentiation.

The Activity of Recombinant Human CD257/TNFSF13B

Recombinant Human CD257/TNFSF13B plays a crucial role in regulating the survival and maturation of B cells. It is a potent B cell growth factor that promotes the survival of mature B cells and stimulates the proliferation of B cell precursors. It also plays a critical role in the development of B cell tolerance, preventing the activation of autoreactive B cells that could lead to autoimmune diseases.

In addition to its effects on B cells, CD257/TNFSF13B also plays a role in the activation of T cells and dendritic cells. It can enhance T cell proliferation and cytokine production, as well as promote the maturation and activation of dendritic cells. This makes it an essential factor in the initiation of an immune response.

The Application of Recombinant Human CD257/TNFSF13B

Recombinant Human CD257/TNFSF13B has been widely used in research and clinical applications due to its crucial role in the immune system. One of its primary applications is in the study of B cell biology, as it is a potent B cell growth factor. It has also been used in the development of therapeutic strategies for B cell-related diseases, such as B cell lymphomas and autoimmune disorders.

In addition, recombinant CD257/TNFSF13B has been used in the development of vaccines and immunotherapies. Its ability to activate T cells and dendritic cells makes it a promising candidate for enhancing immune responses to vaccines and treating cancer through immunotherapy.

Furthermore, recombinant CD257/TNFSF13B has been used in the diagnosis and monitoring of autoimmune diseases. Elevated levels of CD257/TNFSF13B have been found in patients with autoimmune disorders such as systemic lupus erythematosus and rheumatoid arthritis. Measuring the levels of CD257/TNFSF13B in these patients can aid in diagnosis and disease monitoring.

In conclusion, Recombinant Human CD257/TNFSF13B is a crucial protein in the immune system with diverse roles in B cell, T cell, and dendritic cell functions. Its structure, activity, and applications have made it a valuable tool in research and a potential therapeutic target for various diseases.

Recombinant Human CD257/TNFSF13B, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD257/TNFSF13B, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products