Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ATP6V1E1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P36543
Molecular weight:
28.31 kDa

Original price was: $307.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Met1–Asp226
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ATP6V1E1 Protein, N-His

Product name ARO-P11632-100
Uniprot ID P36543
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Molecular weight 28.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp226
Aliases /Synonyms ATP6E, ATP6E2, ATP6V1E1, V-ATPase 31 kDa subunit, V-ATPase subunit E 1, p31, V-type proton ATPase subunit E 1, Vacuolar proton pump subunit E 1
Reference ARO-P11632
Note For research use only.
Molecular Constructor
Met1–Asp226
Product name ARO-P11632-1MG
Uniprot ID P36543
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Molecular weight 28.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp226
Aliases /Synonyms ATP6E, ATP6E2, ATP6V1E1, V-ATPase 31 kDa subunit, V-ATPase subunit E 1, p31, V-type proton ATPase subunit E 1, Vacuolar proton pump subunit E 1
Reference ARO-P11632
Note For research use only.
Molecular Constructor
Met1–Asp226
Product name ARO-P11632-50
Uniprot ID P36543
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
Molecular weight 28.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp226
Aliases /Synonyms ATP6E, ATP6E2, ATP6V1E1, V-ATPase 31 kDa subunit, V-ATPase subunit E 1, p31, V-type proton ATPase subunit E 1, Vacuolar proton pump subunit E 1
Reference ARO-P11632
Note For research use only.
Molecular Constructor
Met1–Asp226

Introduction

Recombinant Human ATP6V1E1 Protein, also known as vacuolar ATPase subunit E1, is a protein that plays a crucial role in the functioning of the vacuolar ATPase complex. This protein is encoded by the ATP6V1E1 gene and is a member of the ATPase family. It is involved in the regulation of intracellular pH and plays a vital role in various cellular processes such as endocytosis, exocytosis, and protein sorting. In this article, we will discuss the structure, activity, and application of Recombinant Human ATP6V1E1 Protein.

Structure of Recombinant Human ATP6V1E1 Protein

Recombinant Human ATP6V1E1 Protein is a 35 kDa protein consisting of 303 amino acids. It is a single-pass transmembrane protein with a large cytoplasmic domain and a smaller extracellular domain. The cytoplasmic domain contains the ATP-binding site, which is essential for the functioning of the protein. The extracellular domain is responsible for binding to other subunits of the vacuolar ATPase complex.

Activity of Recombinant Human ATP6V1E1 Protein

The main activity of Recombinant Human ATP6V1E1 Protein is to form a part of the vacuolar ATPase complex. This complex is responsible for maintaining the acidic environment inside the cell by pumping protons from the cytoplasm into the vacuole. This process is essential for various cellular processes, including endocytosis, exocytosis, and protein sorting.

Apart from its role in regulating intracellular pH, Recombinant Human ATP6V1E1 Protein also plays a crucial role in maintaining the integrity of the Golgi apparatus. It is involved in the regulation of Golgi pH, which is necessary for the proper functioning of this organelle. Additionally, this protein also plays a role in the formation and maintenance of lysosomes, which are responsible for degrading cellular waste and foreign substances.

Application of Recombinant Human ATP6V1E1 Protein

The unique structure and activity of Recombinant Human ATP6V1E1 Protein make it a valuable tool in various research and medical applications. Some of the key applications of this protein are:

1. Study of vacuolar ATPase complex

Recombinant Human ATP6V1E1 Protein is widely used in the study of the vacuolar ATPase complex. Its ability to form a part of this complex makes it an ideal target for understanding the structure and function of this essential cellular machinery.

2. Drug discovery

The role of Recombinant Human ATP6V1E1 Protein in regulating intracellular pH and maintaining the integrity of the Golgi apparatus makes it a potential target for drug discovery. Modulation of this protein’s activity could lead to the development of new drugs for various diseases, including cancer and neurodegenerative disorders.

3. Diagnostic tool

Recombinant Human ATP6V1E1 Protein can also be used as a diagnostic tool for various diseases. Changes in the expression or activity of this protein have been linked to several diseases, and its detection in patient samples could aid in early diagnosis and treatment.

4. Vaccine development

Recombinant Human ATP6V1E1 Protein has also been studied as a potential antigen for vaccine development. Its role in regulating intracellular pH and maintaining the integrity of the Golgi apparatus makes it an attractive target for developing vaccines against infections caused by intracellular pathogens.

Conclusion

Recombinant Human ATP6V1E1 Protein is a crucial component of the vacuolar ATPase complex, playing a vital role in regulating intracellular pH and maintaining the integrity of various cellular organelles. Its unique structure and activity make it a valuable tool in various research and medical applications, including

Recombinant Human ATP6V1E1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ATP6V1E1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products