Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CBX5 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P45973
Molecular weight:
21.73 kDa

Original price was: $326.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Gly2–Lys80
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CBX5 Protein, N-His-SUMO

Product name ARO-P12193-100
Uniprot ID P45973
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK
Molecular weight 21.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Lys80
Aliases /Synonyms Heterochromatin protein 1 homolog alpha, Chromobox protein homolog 5, HP1A, Antigen p25, HP1 alpha, CBX5
Reference ARO-P12193
Note For research use only.
Molecular Constructor
Gly2–Lys80
Product name ARO-P12193-1MG
Uniprot ID P45973
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK
Molecular weight 21.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Lys80
Aliases /Synonyms Heterochromatin protein 1 homolog alpha, Chromobox protein homolog 5, HP1A, Antigen p25, HP1 alpha, CBX5
Reference ARO-P12193
Note For research use only.
Molecular Constructor
Gly2–Lys80
Product name ARO-P12193-50
Uniprot ID P45973
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK
Molecular weight 21.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Lys80
Aliases /Synonyms Heterochromatin protein 1 homolog alpha, Chromobox protein homolog 5, HP1A, Antigen p25, HP1 alpha, CBX5
Reference ARO-P12193
Note For research use only.
Molecular Constructor
Gly2–Lys80

Introduction

Recombinant Human CBX5 Protein, also known as Chromobox protein homolog 5, is a highly conserved protein that plays a crucial role in epigenetic regulation. This protein is encoded by the CBX5 gene and is a member of the chromobox (CBX) family of proteins. CBX5 is involved in various cellular processes such as gene expression, DNA repair, and cell differentiation. In this article, we will discuss the structure, activity, and applications of recombinant human CBX5 protein.

Structure of Recombinant Human CBX5 Protein

The CBX5 protein is composed of 192 amino acids and has a molecular weight of approximately 21 kDa. It contains a chromodomain, a highly conserved region found in all CBX family members, which is responsible for binding to methylated lysine residues on histone proteins. CBX5 also has a polycomb group (PcG) box, which is involved in protein-protein interactions and plays a role in the formation of large protein complexes. The protein also has a nuclear localization signal, indicating its function in the nucleus.

Activity of Recombinant Human CBX5 Protein

CBX5 is a key component of the polycomb repressive complex 1 (PRC1), which is involved in gene silencing and epigenetic regulation. The chromodomain of CBX5 binds to histone H3 lysine 27 trimethylation (H3K27me3), a histone modification associated with gene repression. This interaction recruits PRC1 to specific regions of chromatin, leading to the compaction of DNA and the inhibition of gene expression.

In addition to its role in gene silencing, CBX5 also plays a role in DNA repair. It has been shown to interact with and recruit the DNA repair protein BRCA1 to sites of DNA damage, promoting efficient repair of double-strand breaks. This activity of CBX5 is crucial for maintaining genomic stability and preventing the development of diseases such as cancer.

Applications of Recombinant Human CBX5 Protein

The recombinant form of CBX5 protein has been widely used in various research applications. One of its main uses is in the study of epigenetics and chromatin remodeling. Researchers use recombinant CBX5 protein to investigate the role of this protein in gene regulation and its interactions with other proteins involved in epigenetic processes.

Recombinant CBX5 protein has also been utilized in drug discovery and development. As CBX5 is involved in various cellular processes, it has been identified as a potential target for therapeutic interventions. By studying the structure and activity of recombinant CBX5 protein, researchers can design drugs that specifically target this protein and potentially treat diseases associated with its dysregulation.

Furthermore, recombinant CBX5 protein has been used in diagnostic assays for diseases such as cancer. As CBX5 is involved in DNA repair and gene regulation, its expression levels and activity can serve as biomarkers for certain types of cancer. By using recombinant CBX5 protein in diagnostic tests, clinicians can accurately detect and monitor the progression of cancer in patients.

Conclusion

In conclusion, recombinant human CBX5 protein is a crucial player in epigenetic regulation and DNA repair. Its unique structure and activity make it an important target for research and drug development. The recombinant form of this protein has been widely used in various applications, including epigenetic studies, drug discovery, and diagnostic assays. Further research on CBX5 and its functions will continue to provide valuable insights into the complex world of epigenetics and its role in human health and disease.

Recombinant Human CBX5 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CBX5 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products