Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD81 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P60033
Molecular weight:
22.11 kDa

Original price was: $276.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Phe113–Lys201
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD81 Protein, N-His-SUMO

Product name ARO-P12635-100
Uniprot ID P60033
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113-Lys201
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-P12635
Note For research use only.
Molecular Constructor
Phe113–Lys201
Product name ARO-P12635-1MG
Uniprot ID P60033
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113-Lys201
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-P12635
Note For research use only.
Molecular Constructor
Phe113–Lys201
Product name ARO-P12635-50
Uniprot ID P60033
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113-Lys201
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-P12635
Note For research use only.
Molecular Constructor
Phe113–Lys201

Introduction

Recombinant Human CD81 Protein, also known as TAPA-1, is a transmembrane protein that plays a crucial role in various cellular processes. It is a member of the tetraspanin family and is highly expressed on the surface of many cell types, including T cells, B cells, and epithelial cells. Recombinant CD81 protein is a valuable tool for studying the structure, function, and interactions of this important protein.

Structure of Recombinant Human CD81 Protein

The CD81 protein is composed of 236 amino acids and has a molecular weight of approximately 26 kDa. It is composed of four transmembrane domains, two extracellular loops, and two intracellular loops. The N-terminal extracellular loop contains a highly conserved cysteine-rich region, while the C-terminal extracellular loop contains a variable region. The intracellular loops are involved in protein-protein interactions and signaling pathways.

Recombinant CD81 protein is produced using recombinant DNA technology and is expressed in a variety of host cells, including bacteria, yeast, and mammalian cells. The protein is then purified to achieve high levels of purity and activity.

Function of Recombinant Human CD81 Protein

CD81 protein is involved in a wide range of biological processes, including cell adhesion, migration, and signaling. It is a key component of the tetraspanin-enriched microdomains (TEMs) on the cell surface, which act as platforms for the organization and regulation of various signaling pathways. CD81 also interacts with other tetraspanins, as well as with integrins, immunoglobulins, and other cell surface receptors, to modulate cell adhesion and signaling.

One of the most well-studied functions of CD81 is its role in viral entry. The protein is a receptor for the hepatitis C virus (HCV) and is also involved in the entry of other viruses, including Ebola and Dengue viruses. CD81 interacts with viral envelope proteins and facilitates their fusion with the host cell membrane, allowing the virus to enter and infect the cell.

Applications of Recombinant Human CD81 Protein

Recombinant CD81 protein has a wide range of applications in both basic research and clinical settings. In research, it is used as a tool to study the structure and function of the protein, as well as its interactions with other molecules. It is also used to investigate the role of CD81 in various biological processes, such as viral entry and immune responses.

In the clinical setting, recombinant CD81 protein has potential applications in the development of antiviral therapies. By blocking the interaction between CD81 and viral envelope proteins, it may be possible to prevent viral entry and infection. In addition, CD81 is also being studied as a potential target for cancer therapy, as it is overexpressed on the surface of many cancer cells and plays a role in tumor growth and metastasis.

Conclusion

Recombinant Human CD81 Protein is a versatile and valuable tool for studying the structure, function, and interactions of this important protein. Its diverse functions in various biological processes, as well as its potential applications in antiviral and cancer therapies, make it a highly sought-after protein in the scientific community. The use of recombinant technology has allowed for the production of high-quality and highly active CD81 protein, making it an essential component in many research and clinical studies.

Recombinant Human CD81 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CD81 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products