Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EGFL7, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UHF1
Molecular weight:
29.43 kDa

Original price was: $339.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Tyr24–Ser273
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EGFL7, N-His

Product name ARO-P13030-100
Uniprot ID Q9UHF1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Molecular weight 29.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr24-Ser273
Aliases /Synonyms NOTCH4-like protein, Zneu1, Multiple EGF-like domains protein 7, Epidermal growth factor-like protein 7, MEGF7, EGFL7, VE-statin, EGF-like protein 7, Multiple epidermal growth factor-like domains protein 7, Vascular endothelial statin
Reference ARO-P13030
Note For research use only.
Molecular Constructor
Tyr24–Ser273
Product name ARO-P13030-1MG
Uniprot ID Q9UHF1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Molecular weight 29.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr24-Ser273
Aliases /Synonyms NOTCH4-like protein, Zneu1, Multiple EGF-like domains protein 7, Epidermal growth factor-like protein 7, MEGF7, EGFL7, VE-statin, EGF-like protein 7, Multiple epidermal growth factor-like domains protein 7, Vascular endothelial statin
Reference ARO-P13030
Note For research use only.
Molecular Constructor
Tyr24–Ser273
Product name ARO-P13030-50
Uniprot ID Q9UHF1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Molecular weight 29.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr24-Ser273
Aliases /Synonyms NOTCH4-like protein, Zneu1, Multiple EGF-like domains protein 7, Epidermal growth factor-like protein 7, MEGF7, EGFL7, VE-statin, EGF-like protein 7, Multiple epidermal growth factor-like domains protein 7, Vascular endothelial statin
Reference ARO-P13030
Note For research use only.
Molecular Constructor
Tyr24–Ser273

Introduction to Recombinant Human EGFL7

Recombinant Human EGFL7 (Epidermal Growth Factor-like Domain 7) is a protein that plays a crucial role in various biological processes, including angiogenesis, tumor growth, and inflammation. It is a member of the epidermal growth factor (EGF) family of proteins and is encoded by the EGFL7 gene.

Structure of Recombinant Human EGFL7

Recombinant Human EGFL7 is a 25 kDa protein that is composed of 240 amino acids. It contains a single EGF-like domain, which is responsible for its biological activity. The protein also has a signal peptide at the N-terminus, which allows for its secretion from cells. The EGF-like domain of EGFL7 is highly conserved among species, with 92% sequence identity between human and mouse EGFL7.

Activity of Recombinant Human EGFL7

Recombinant Human EGFL7 has been shown to have pro-angiogenic activity, promoting the growth of new blood vessels. This activity is mediated through its interaction with the EGF receptor (EGFR) and the vascular endothelial growth factor receptor 2 (VEGFR2). EGFL7 binds to these receptors and activates downstream signaling pathways, leading to the proliferation and migration of endothelial cells, which are essential for angiogenesis.

In addition to its role in angiogenesis, Recombinant Human EGFL7 has also been shown to have anti-inflammatory activity. It can inhibit the production of pro-inflammatory cytokines, such as TNF-α and IL-6, by macrophages. This anti-inflammatory activity is beneficial in various inflammatory conditions, such as rheumatoid arthritis and atherosclerosis.

Furthermore, Recombinant Human EGFL7 has been found to promote tumor growth and metastasis. It can stimulate the proliferation and migration of tumor cells, as well as the formation of new blood vessels within the tumor. This activity is mediated through its interaction with EGFR and VEGFR2, as well as the integrin αvβ3, which is highly expressed on tumor cells.

Application of Recombinant Human EGFL7

Recombinant Human EGFL7 has a wide range of potential applications in both research and therapeutic settings. Its pro-angiogenic activity makes it a valuable tool for studying the mechanisms of angiogenesis and developing new therapies for diseases that involve abnormal blood vessel growth, such as cancer and diabetic retinopathy.

Furthermore, Recombinant Human EGFL7 has potential as a therapeutic agent for the treatment of various diseases. Its anti-inflammatory activity makes it a promising candidate for the treatment of inflammatory conditions, and its pro-tumor activity could be harnessed for the treatment of certain types of cancer. In fact, a phase I clinical trial is currently underway to evaluate the safety and efficacy of a recombinant EGFL7 protein in patients with advanced solid tumors.

In addition, Recombinant Human EGFL7 has potential as a diagnostic tool. Its expression has been found to be elevated in the serum of patients with various types of cancer, making it a potential biomarker for cancer diagnosis and monitoring.

Conclusion

Recombinant Human EGFL7 is a multifunctional protein with important roles in angiogenesis, inflammation, and cancer. Its structure, activity, and potential applications make it a valuable tool for research and a promising candidate for therapeutic and diagnostic purposes. Further studies on the mechanisms of EGFL7 and its interactions with other proteins could lead to the development of novel treatments for various diseases.

Recombinant Human EGFL7, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EGFL7, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products