Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CDCA2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q69YH5
Molecular weight:
34.72 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Ala383–Glu441
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CDCA2 Protein, N-GST & C-His

Product name ARO-P11301-100
Uniprot ID Q69YH5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTPVCKKDFSGLSSLLLEQSPVPE
Molecular weight 34.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala383-Glu441
Aliases /Synonyms Repo-Man, Recruits PP1 onto mitotic chromatin at anaphase protein, CDCA2, Cell division cycle-associated protein 2
Reference ARO-P11301
Note For research use only.
Molecular Constructor
Ala383–Glu441
Product name ARO-P11301-1MG
Uniprot ID Q69YH5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTPVCKKDFSGLSSLLLEQSPVPE
Molecular weight 34.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala383-Glu441
Aliases /Synonyms Repo-Man, Recruits PP1 onto mitotic chromatin at anaphase protein, CDCA2, Cell division cycle-associated protein 2
Reference ARO-P11301
Note For research use only.
Molecular Constructor
Ala383–Glu441
Product name ARO-P11301-50
Uniprot ID Q69YH5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTPVCKKDFSGLSSLLLEQSPVPE
Molecular weight 34.72 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala383-Glu441
Aliases /Synonyms Repo-Man, Recruits PP1 onto mitotic chromatin at anaphase protein, CDCA2, Cell division cycle-associated protein 2
Reference ARO-P11301
Note For research use only.
Molecular Constructor
Ala383–Glu441

Introduction

Recombinant Human CDCA2 Protein, also known as cell division cycle-associated protein 2, is a key protein involved in the regulation of cell division and proliferation. It is a highly conserved protein that is found in all eukaryotic organisms and plays an essential role in maintaining genomic stability. In this article, we will discuss the structure, activity, and applications of Recombinant Human CDCA2 Protein.

Structure of Recombinant Human CDCA2 Protein

Recombinant Human CDCA2 Protein is a 33 kDa protein that consists of 297 amino acids. It contains an N-terminal domain and a C-terminal domain, which are connected by a flexible linker region. The N-terminal domain is responsible for the binding of CDCA2 to its target proteins, while the C-terminal domain is involved in the regulation of its activity.

The crystal structure of Recombinant Human CDCA2 Protein has been determined, revealing a compact globular structure with a central beta-sheet surrounded by alpha-helices. This structure is highly conserved among different species, indicating the importance of CDCA2 in cellular processes.

Activity of Recombinant Human CDCA2 Protein

Recombinant Human CDCA2 Protein is a key regulator of cell division and proliferation. It is involved in the G2/M phase transition of the cell cycle, where it promotes the entry of cells into mitosis. CDCA2 achieves this by interacting with other cell cycle proteins, such as cyclin-dependent kinase 1 (CDK1) and cyclin B1, to form a complex that regulates the progression of the cell cycle.

In addition to its role in cell cycle regulation, Recombinant Human CDCA2 Protein has also been shown to play a role in DNA repair. It interacts with other proteins involved in DNA damage response, such as BRCA1 and RAD51, to promote efficient repair of DNA damage and maintain genomic stability.

Applications of Recombinant Human CDCA2 Protein

Recombinant Human CDCA2 Protein has a wide range of applications in both research and clinical settings. Its role in cell cycle regulation makes it a valuable tool for studying cell division and proliferation. It can be used to investigate the mechanisms involved in cell cycle progression and to identify potential targets for cancer therapy.

In addition, Recombinant Human CDCA2 Protein has potential diagnostic and prognostic applications in cancer. It has been found to be overexpressed in several types of cancer, including breast, lung, and colorectal cancer. This overexpression has been associated with poor prognosis and increased tumor aggressiveness. Therefore, measuring CDCA2 levels in cancer cells could provide valuable information for cancer diagnosis and treatment.

Moreover, Recombinant Human CDCA2 Protein has been explored as a potential therapeutic target for cancer treatment. Inhibiting CDCA2 activity has been shown to induce cell cycle arrest and reduce tumor growth in preclinical studies. This makes CDCA2 a promising target for the development of novel cancer therapies.

Conclusion

In conclusion, Recombinant Human CDCA2 Protein is a key protein involved in cell cycle regulation and maintenance of genomic stability. Its highly conserved structure and essential role in cellular processes make it a valuable tool for research and potential target for cancer therapy. Further studies on the structure and activity of CDCA2 will provide a better understanding of its functions and potential applications in various fields.

Recombinant Human CDCA2 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human CDCA2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products