Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human COPS8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99627
Molecular weight:
20.73 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Met1–Lys166
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human COPS8 Protein, N-His

Product name ARO-P12071-100
Uniprot ID Q99627
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRK
Molecular weight 20.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys166
Aliases /Synonyms hCOP9, COPS8, COP9 signalosome complex subunit 8, COP9 homolog, Signalosome subunit 8, JAB1-containing signalosome subunit 8, SGN8, CSN8
Reference ARO-P12071
Note For research use only.
Molecular Constructor
Met1–Lys166
Product name ARO-P12071-1MG
Uniprot ID Q99627
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRK
Molecular weight 20.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys166
Aliases /Synonyms hCOP9, COPS8, COP9 signalosome complex subunit 8, COP9 homolog, Signalosome subunit 8, JAB1-containing signalosome subunit 8, SGN8, CSN8
Reference ARO-P12071
Note For research use only.
Molecular Constructor
Met1–Lys166
Product name ARO-P12071-50
Uniprot ID Q99627
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRK
Molecular weight 20.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys166
Aliases /Synonyms hCOP9, COPS8, COP9 signalosome complex subunit 8, COP9 homolog, Signalosome subunit 8, JAB1-containing signalosome subunit 8, SGN8, CSN8
Reference ARO-P12071
Note For research use only.
Molecular Constructor
Met1–Lys166

Introduction

Recombinant Human COPS8 Protein, also known as COP9 Signalosome Complex Subunit 8, is a protein that plays a crucial role in regulating protein degradation and cell cycle progression. This protein is produced through recombinant technology, making it a valuable tool in scientific research and potential therapeutic applications. In this article, we will discuss the structure, activity, and potential applications of Recombinant Human COPS8 Protein.

Structure of Recombinant Human COPS8 Protein

Recombinant Human COPS8 Protein is a 25 kDa protein that consists of 228 amino acids. It is composed of a highly conserved N-terminal domain and a less conserved C-terminal domain. The N-terminal domain contains a coiled-coil region, which is involved in protein-protein interactions, while the C-terminal domain contains a JAB1/MPN/Mov34 metalloenzyme (JAMM) motif, which is responsible for its enzymatic activity.

Activity of Recombinant Human COPS8 Protein

Recombinant Human COPS8 Protein is a subunit of the COP9 signalosome (CSN) complex, which is a highly conserved protein complex that regulates the activity of cullin-RING E3 ubiquitin ligases (CRLs). CRLs are responsible for targeting specific proteins for degradation through the ubiquitin-proteasome pathway. The CSN complex acts as a deneddylase, removing the NEDD8 modification from cullins, thereby regulating their activity and preventing premature degradation of target proteins.

Recombinant Human COPS8 Protein specifically binds to cullin-2 and cullin-5, two members of the CRL family, and enhances their deneddylation activity. This activity is essential for proper cell cycle progression and cellular homeostasis. In addition, Recombinant Human COPS8 Protein has been shown to interact with various other proteins, including transcription factors, kinases, and cell cycle regulators, suggesting its involvement in a wide range of cellular processes.

Applications of Recombinant Human COPS8 Protein

Recombinant Human COPS8 Protein has various applications in both basic research and potential therapeutic interventions. One of its main uses is in studying the function of the CSN complex and its role in regulating protein degradation. By using recombinant COPS8 protein, researchers can manipulate the activity of the CSN complex and study its effects on various cellular processes.

Furthermore, Recombinant Human COPS8 Protein has been implicated in various diseases, including cancer and neurodegenerative disorders. Its involvement in regulating the activity of CRLs makes it a potential target for therapeutic interventions. By targeting Recombinant Human COPS8 Protein, researchers can potentially modulate the activity of CRLs and prevent the degradation of specific proteins that contribute to disease progression.

In addition, Recombinant Human COPS8 Protein can also be used as an antigen for antibody production. Its high expression in various tissues and its involvement in multiple cellular processes make it an attractive target for generating specific antibodies for research and diagnostic purposes.

Conclusion

Recombinant Human COPS8 Protein is a crucial component of the CSN complex, which plays a vital role in regulating protein degradation and cell cycle progression. Its structure, activity, and potential applications make it a valuable tool in scientific research and a potential target for therapeutic interventions. As our understanding of this protein continues to grow, so does its potential for further advancements in various fields of study.

Recombinant Human COPS8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human COPS8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products