Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CXCL10/IP-10 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P02778
Molecular weight:
22.27 kDa

Original price was: $312.00.Current price is: $274.00.

50ug 12% OFF + 274 loyalty points
Val22–Pro98
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CXCL10/IP-10 Protein, N-His-SUMO & C-Strep

Product name ARO-P11711-100
Uniprot ID P02778
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Molecular weight 22.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Pro98
Aliases /Synonyms Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference ARO-P11711
Note For research use only.
Molecular Constructor
Val22–Pro98
Product name ARO-P11711-1MG
Uniprot ID P02778
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Molecular weight 22.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Pro98
Aliases /Synonyms Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference ARO-P11711
Note For research use only.
Molecular Constructor
Val22–Pro98
Product name ARO-P11711-50
Uniprot ID P02778
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Molecular weight 22.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Pro98
Aliases /Synonyms Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference ARO-P11711
Note For research use only.
Molecular Constructor
Val22–Pro98

Introduction

Recombinant Human CXCL10/IP-10 Protein is a highly versatile and potent chemokine that plays a crucial role in various physiological and pathological processes. This protein is produced through recombinant DNA technology, making it a valuable tool for research and therapeutic applications. In this article, we will discuss the structure, activity, and applications of Recombinant Human CXCL10/IP-10 Protein.

Structure of Recombinant Human CXCL10/IP-10 Protein

Recombinant Human CXCL10/IP-10 Protein is a small protein consisting of 98 amino acids with a molecular weight of approximately 11 kDa. It belongs to the CXC chemokine family and is produced by various cell types, including monocytes, macrophages, and endothelial cells. The protein is composed of three anti-parallel beta strands and one alpha helix, forming a characteristic chemokine fold.

The primary structure of Recombinant Human CXCL10/IP-10 Protein is highly conserved among different species, with 91% amino acid sequence identity between human and mouse proteins. This high level of conservation suggests that the protein plays a critical role in biological processes and is essential for the proper functioning of the immune system.

Activity of Recombinant Human CXCL10/IP-10 Protein

Recombinant Human CXCL10/IP-10 Protein acts as a potent chemoattractant for various immune cells, including T cells, natural killer cells, and dendritic cells. It exerts its effects by binding to its receptor, CXCR3, which is expressed on the surface of these cells. This interaction triggers a signaling cascade, leading to cell migration towards the site of infection or inflammation.

In addition to its chemotactic activity, Recombinant Human CXCL10/IP-10 Protein also has anti-angiogenic properties. It can inhibit the growth of new blood vessels, which is crucial in controlling tumor growth and metastasis. Moreover, this protein has been shown to have antiviral activity, particularly against viruses such as hepatitis C and HIV.

Applications of Recombinant Human CXCL10/IP-10 Protein

Due to its diverse biological activities, Recombinant Human CXCL10/IP-10 Protein has numerous potential applications in both research and therapeutics. In research, this protein is commonly used as a chemoattractant to study the migration of immune cells in various disease models. It is also used to investigate the role of CXCL10/IP-10 in immune responses and inflammation.

In therapeutics, Recombinant Human CXCL10/IP-10 Protein has shown promising results in the treatment of various diseases. Its anti-angiogenic properties make it a potential candidate for cancer therapy, especially in combination with other chemotherapeutic agents. This protein has also been studied for its potential use in the treatment of autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis, due to its ability to regulate immune cell migration.

Moreover, Recombinant Human CXCL10/IP-10 Protein has been investigated as a potential biomarker for various diseases. Its levels have been found to be elevated in conditions such as viral infections, autoimmune diseases, and certain types of cancer. This makes it a valuable tool for disease diagnosis and monitoring.

Conclusion

In summary, Recombinant Human CXCL10/IP-10 Protein is a highly versatile chemokine with diverse biological activities. Its structure, activity, and potential applications make it a valuable tool for both research and therapeutics. As our understanding of this protein continues to grow, it is likely to have even more significant implications in the field of medicine.

Recombinant Human CXCL10/IP-10 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human CXCL10/IP-10 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products