Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ELAVL3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14576
Molecular weight:
20.91 kDa

Original price was: $455.00.Current price is: $392.00.

100ug 14% OFF + 392 loyalty points
Asp35–Ala203
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ELAVL3 Protein, N-His

Product name ARO-P11253-100
Uniprot ID Q14576
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFA
Molecular weight 20.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp35-Ala203
Aliases /Synonyms HUC, Hu-antigen C, HuC, ELAV-like protein 3, ELAVL3, Paraneoplastic cerebellar degeneration-associated antigen, PLE21, Paraneoplastic limbic encephalitis antigen 21
Reference ARO-P11253
Note For research use only.
Molecular Constructor
Asp35–Ala203
Product name ARO-P11253-1MG
Uniprot ID Q14576
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFA
Molecular weight 20.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp35-Ala203
Aliases /Synonyms HUC, Hu-antigen C, HuC, ELAV-like protein 3, ELAVL3, Paraneoplastic cerebellar degeneration-associated antigen, PLE21, Paraneoplastic limbic encephalitis antigen 21
Reference ARO-P11253
Note For research use only.
Molecular Constructor
Asp35–Ala203
Product name ARO-P11253-50
Uniprot ID Q14576
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFA
Molecular weight 20.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp35-Ala203
Aliases /Synonyms HUC, Hu-antigen C, HuC, ELAV-like protein 3, ELAVL3, Paraneoplastic cerebellar degeneration-associated antigen, PLE21, Paraneoplastic limbic encephalitis antigen 21
Reference ARO-P11253
Note For research use only.
Molecular Constructor
Asp35–Ala203

Recombinant Human ELAVL3 Protein: Structure, Activity, and Application

Introduction

Recombinant proteins have become essential tools in various fields of research, diagnostics, and therapeutics. One such protein is the Recombinant Human ELAVL3 Protein, which has gained significant attention due to its crucial role in regulating gene expression and its potential as a therapeutic target. In this article, we will delve into the structure, activity, and applications of this important recombinant protein.

Structure of Recombinant Human ELAVL3 Protein

The Recombinant Human ELAVL3 Protein is a member of the ELAVL family of RNA-binding proteins. It is encoded by the ELAVL3 gene and is composed of 443 amino acids with a molecular weight of approximately 50 kDa. The protein contains three RNA recognition motifs (RRMs) and a C-terminal domain (CTD) that are essential for its RNA-binding activity.

The three RRMs in the protein are responsible for binding to specific sequences in the target RNA molecules, while the CTD is involved in protein-protein interactions and regulates the RNA-binding activity of ELAVL3. The protein also has a nuclear localization signal (NLS) that enables it to shuttle between the nucleus and the cytoplasm, where it performs its functions.

Activity of Recombinant Human ELAVL3 Protein

The main function of Recombinant Human ELAVL3 Protein is to regulate the stability and translation of target mRNAs. It does so by binding to AU-rich elements (AREs) in the 3′ untranslated region (UTR) of mRNA molecules, which can either enhance or suppress their translation. ELAVL3 has been shown to bind to AREs in a sequence-specific manner, and its binding has been linked to the stability of several important mRNAs, including those encoding for cytokines, growth factors, and cell cycle regulators.

In addition to its role in regulating gene expression, Recombinant Human ELAVL3 Protein has also been implicated in various cellular processes, such as cell differentiation, apoptosis, and stress response. It has been shown to interact with other proteins involved in these processes, further highlighting its multifaceted activity in the cell.

Applications of Recombinant Human ELAVL3 Protein

The unique structure and activity of Recombinant Human ELAVL3 Protein make it a valuable tool in various areas of research and medicine. One of its primary applications is in studying the regulation of gene expression. Researchers can use the recombinant protein to investigate the mechanisms underlying mRNA stability and translation, as well as its role in different cellular processes.

Moreover, the aberrant expression of ELAVL3 has been linked to several diseases, including cancer, neurodegenerative disorders, and autoimmune diseases. Therefore, the recombinant protein can also be used as a potential therapeutic target for these conditions. Researchers can develop inhibitors or modulators of ELAVL3 activity to treat these diseases or use the protein as a diagnostic marker for their detection.

The use of Recombinant Human ELAVL3 Protein in biotechnology is also gaining momentum. It has been incorporated into various expression systems to enhance the production of recombinant proteins in mammalian cells. ELAVL3 has been shown to increase the stability and translation of target mRNAs, leading to higher yields of the desired recombinant protein.

Conclusion

In conclusion, Recombinant Human ELAVL3 Protein is a versatile and essential tool in the field of biotechnology and biomedical research. Its unique structure and activity make it a valuable tool for studying gene expression, cellular processes, and disease mechanisms. Furthermore, its potential as a therapeutic target and

Recombinant Human ELAVL3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ELAVL3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products