Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FOXA3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P55318
Molecular weight:
21.95 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Ser121–Glu202
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FOXA3 Protein, N-His-SUMO

Product name ARO-P11313-100
Uniprot ID P55318
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFE
Molecular weight 21.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser121-Glu202
Aliases /Synonyms TCF-3G, TCF3G, Fork head-related protein FKH H3, HNF-3-gamma, HNF-3G, HNF3G, FOXA3, Hepatocyte nuclear factor 3-gamma, Forkhead box protein A3, Transcription factor 3G
Reference ARO-P11313
Note For research use only.
Molecular Constructor
Ser121–Glu202
Product name ARO-P11313-1MG
Uniprot ID P55318
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFE
Molecular weight 21.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser121-Glu202
Aliases /Synonyms TCF-3G, TCF3G, Fork head-related protein FKH H3, HNF-3-gamma, HNF-3G, HNF3G, FOXA3, Hepatocyte nuclear factor 3-gamma, Forkhead box protein A3, Transcription factor 3G
Reference ARO-P11313
Note For research use only.
Molecular Constructor
Ser121–Glu202
Product name ARO-P11313-50
Uniprot ID P55318
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFE
Molecular weight 21.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser121-Glu202
Aliases /Synonyms TCF-3G, TCF3G, Fork head-related protein FKH H3, HNF-3-gamma, HNF-3G, HNF3G, FOXA3, Hepatocyte nuclear factor 3-gamma, Forkhead box protein A3, Transcription factor 3G
Reference ARO-P11313
Note For research use only.
Molecular Constructor
Ser121–Glu202

Introduction to Recombinant Human FOXA3 Protein

Recombinant Human FOXA3 Protein, also known as Forkhead Box A3, is a transcription factor that plays a crucial role in regulating gene expression. This protein is encoded by the FOXA3 gene and is a member of the FOX family of transcription factors. It is involved in various biological processes such as development, metabolism, and differentiation.

Structure of Recombinant Human FOXA3 Protein

The recombinant form of FOXA3 protein is produced through genetic engineering techniques, where the gene for FOXA3 is inserted into a suitable expression vector and then expressed in a host cell. This results in the production of a protein with the same amino acid sequence as the native form.

The recombinant FOXA3 protein has a molecular weight of approximately 50 kDa and consists of 472 amino acids. It contains a conserved DNA-binding domain known as the Forkhead domain, which is responsible for its role as a transcription factor. This domain allows FOXA3 to bind to specific DNA sequences and regulate the expression of target genes.

Activity of Recombinant Human FOXA3 Protein

The activity of FOXA3 protein is primarily mediated through its role as a transcription factor. It binds to specific DNA sequences, known as FOXA3 binding sites, and regulates the expression of target genes. This can either activate or repress the expression of these genes, depending on the cellular context.

FOXA3 has been shown to play a critical role in the development and differentiation of various tissues and organs, including the liver, pancreas, and lung. It is also involved in regulating glucose and lipid metabolism, making it an important factor in metabolic diseases such as diabetes and obesity.

Furthermore, FOXA3 has been linked to cancer development and progression. It has been found to act as a tumor suppressor in certain types of cancer, while promoting tumor growth in others. This highlights the diverse and complex role of FOXA3 in various biological processes.

Application of Recombinant Human FOXA3 Protein

The recombinant form of FOXA3 protein has various applications in both research and therapeutic settings. One of its primary uses is in studying the role of FOXA3 in different biological processes. Recombinant FOXA3 protein can be used to investigate its binding to DNA and the regulation of target genes.

Additionally, the recombinant form of FOXA3 can be used to develop diagnostic and prognostic tools for various diseases. As FOXA3 has been linked to metabolic diseases and cancer, its detection and quantification in patient samples can provide valuable information for disease diagnosis and management.

Moreover, recombinant FOXA3 protein has potential therapeutic applications. It can be used as a target for drug development, particularly in the treatment of metabolic diseases and cancer. By understanding the role of FOXA3 in these diseases, drugs can be designed to target and modulate its activity.

Conclusion

In summary, Recombinant Human FOXA3 Protein is a transcription factor with a crucial role in regulating gene expression. Its structure, activity, and application have been extensively studied and have provided valuable insights into its role in various biological processes. As research continues to unravel the complex functions of FOXA3, the potential for its use in diagnostics and therapeutics will only increase.

Recombinant Human FOXA3 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human FOXA3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products