Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HOXA10 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P31260
Molecular weight:
21.33 kDa

Original price was: $337.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Arg340–Ser410
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HOXA10 Protein, N-His-SUMO

Product name ARO-P11970-100
Uniprot ID P31260
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
Molecular weight 21.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg340-Ser410
Aliases /Synonyms Homeobox protein Hox-1H, Homeobox protein Hox-1.8, HOX1H, PL, HOXA10, Homeobox protein Hox-A10
Reference ARO-P11970
Note For research use only.
Molecular Constructor
Arg340–Ser410
Product name ARO-P11970-1MG
Uniprot ID P31260
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
Molecular weight 21.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg340-Ser410
Aliases /Synonyms Homeobox protein Hox-1H, Homeobox protein Hox-1.8, HOX1H, PL, HOXA10, Homeobox protein Hox-A10
Reference ARO-P11970
Note For research use only.
Molecular Constructor
Arg340–Ser410
Product name ARO-P11970-50
Uniprot ID P31260
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
Molecular weight 21.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg340-Ser410
Aliases /Synonyms Homeobox protein Hox-1H, Homeobox protein Hox-1.8, HOX1H, PL, HOXA10, Homeobox protein Hox-A10
Reference ARO-P11970
Note For research use only.
Molecular Constructor
Arg340–Ser410

Introduction

Recombinant Human HOXA10 Protein is a highly purified and biologically active protein that is produced through recombinant DNA technology. This protein belongs to the homeobox family of transcription factors and plays a crucial role in embryonic development and tissue differentiation. In this article, we will discuss the structure, activity, and applications of this protein in various fields of science.

Structure of Recombinant Human HOXA10 Protein

The recombinant human HOXA10 protein is a 36 kDa protein consisting of 340 amino acids. It contains a conserved DNA-binding domain known as the homeodomain, which is responsible for the specific binding of the protein to DNA sequences. This protein also has a nuclear localization signal, which allows it to enter the nucleus and regulate gene expression. In addition, it has a C-terminal transactivation domain, which is responsible for the activation of target genes.

Activity of Recombinant Human HOXA10 Protein

Recombinant Human HOXA10 Protein is a transcription factor that regulates the expression of target genes by binding to specific DNA sequences. It plays a crucial role in embryonic development, particularly in the formation of the reproductive system, limbs, and central nervous system. This protein also has a role in tissue differentiation, specifically in the development of the uterus and its function during pregnancy. It has been shown to regulate the expression of genes involved in cell proliferation, differentiation, and apoptosis.

Furthermore, recombinant human HOXA10 protein has been found to be involved in the development and progression of various diseases. Studies have shown that this protein is dysregulated in endometriosis, a gynecological disorder characterized by the growth of endometrial tissue outside the uterus. It has also been linked to certain types of cancer, such as breast and ovarian cancer, where it promotes tumor growth and metastasis.

Applications of Recombinant Human HOXA10 Protein

Due to its crucial role in embryonic development and tissue differentiation, recombinant human HOXA10 protein has various applications in the field of science. One of its main applications is in the study of developmental biology and reproductive system disorders. Researchers use this protein to investigate the mechanisms of embryonic development and the role of HOXA10 in reproductive disorders such as endometriosis and infertility.

Moreover, recombinant human HOXA10 protein has potential therapeutic applications. As it is involved in the development and progression of diseases, it can be targeted for the treatment of endometriosis and certain types of cancer. Studies have shown that inhibiting the activity of this protein can reduce tumor growth and metastasis, making it a potential target for cancer therapy.

Additionally, recombinant human HOXA10 protein has been used in drug discovery and development. By understanding its role in gene regulation and disease development, researchers can identify potential drug targets and develop new treatments for various diseases.

Conclusion

Recombinant Human HOXA10 Protein is a biologically active protein that plays a crucial role in embryonic development and tissue differentiation. Its structure, activity, and applications have been extensively studied, and it has been found to have potential therapeutic applications in reproductive disorders and cancer. With ongoing research and advancements in technology, this protein continues to be a valuable tool in the study of developmental biology and disease mechanisms.

Recombinant Human HOXA10 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human HOXA10 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products