Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL12RB2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99665
Molecular weight:
17.55 kDa

Original price was: $486.00.Current price is: $392.00.

100ug 19% OFF + 392 loyalty points
Trp145–Ala275
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL12RB2, N-His

Product name ARO-P13154-100
Uniprot ID Q99665
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKA
Molecular weight 17.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp145-Ala275
Aliases /Synonyms IL-12R subunit beta-2, IL-12 receptor subunit beta-2, IL-12R-beta-2, Interleukin-12 receptor subunit beta-2, IL12RB2, IL-12RB2
Reference ARO-P13154
Note For research use only.
Molecular Constructor
Trp145–Ala275
Product name ARO-P13154-1MG
Uniprot ID Q99665
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKA
Molecular weight 17.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp145-Ala275
Aliases /Synonyms IL-12R subunit beta-2, IL-12 receptor subunit beta-2, IL-12R-beta-2, Interleukin-12 receptor subunit beta-2, IL12RB2, IL-12RB2
Reference ARO-P13154
Note For research use only.
Molecular Constructor
Trp145–Ala275
Product name ARO-P13154-50
Uniprot ID Q99665
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKA
Molecular weight 17.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp145-Ala275
Aliases /Synonyms IL-12R subunit beta-2, IL-12 receptor subunit beta-2, IL-12R-beta-2, Interleukin-12 receptor subunit beta-2, IL12RB2, IL-12RB2
Reference ARO-P13154
Note For research use only.
Molecular Constructor
Trp145–Ala275

Recombinant Human IL12RB2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IL12RB2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products