Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KCNA3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P22001
Molecular weight:
17.77 kDa

Original price was: $307.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Arg105–Ser230
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KCNA3 Protein, N-His

Product name ARO-P11766-100
Uniprot ID P22001
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESS
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg105-Ser230
Aliases /Synonyms HGK5, Voltage-gated K(+) channel HuKIII, HLK3, KCNA3, Potassium voltage-gated channel subfamily A member 3, HPCN3, Voltage-gated potassium channel subunit Kv1.3
Reference ARO-P11766
Note For research use only.
Molecular Constructor
Arg105–Ser230
Product name ARO-P11766-1MG
Uniprot ID P22001
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESS
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg105-Ser230
Aliases /Synonyms HGK5, Voltage-gated K(+) channel HuKIII, HLK3, KCNA3, Potassium voltage-gated channel subfamily A member 3, HPCN3, Voltage-gated potassium channel subunit Kv1.3
Reference ARO-P11766
Note For research use only.
Molecular Constructor
Arg105–Ser230
Product name ARO-P11766-50
Uniprot ID P22001
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESS
Molecular weight 17.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg105-Ser230
Aliases /Synonyms HGK5, Voltage-gated K(+) channel HuKIII, HLK3, KCNA3, Potassium voltage-gated channel subfamily A member 3, HPCN3, Voltage-gated potassium channel subunit Kv1.3
Reference ARO-P11766
Note For research use only.
Molecular Constructor
Arg105–Ser230

Title: Introduction to Recombinant Human KCNA3 Protein

Recombinant Human KCNA3 Protein, also known as the voltage-gated potassium channel subfamily A member 3, is a protein that plays a crucial role in regulating the electrical activity of cells. This protein is encoded by the KCNA3 gene and is found in various tissues, including the brain, heart, and skeletal muscles. In this article, we will explore the structure, activity, and applications of Recombinant Human KCNA3 Protein.

Title: Structure of Recombinant Human KCNA3 Protein

Recombinant Human KCNA3 Protein is a transmembrane protein that consists of six subunits, each with four transmembrane domains. These domains form a pore that allows the flow of potassium ions across the cell membrane. The structure of this protein is highly conserved among species, with a high degree of similarity to other potassium channels.

Title: Activity of Recombinant Human KCNA3 Protein

The primary function of Recombinant Human KCNA3 Protein is to regulate the flow of potassium ions across the cell membrane. This activity is essential for maintaining the resting membrane potential of cells, which is crucial for various physiological processes such as muscle contraction and nerve signaling. Recombinant Human KCNA3 Protein is also involved in the repolarization of neurons, which is necessary for proper functioning of the nervous system.

Title: Mechanism of Action

The activity of Recombinant Human KCNA3 Protein is regulated by various mechanisms, including voltage and ligand-gated channels. When a cell is at rest, the channel remains closed, preventing the flow of potassium ions. However, when the cell is stimulated, the channel opens, allowing potassium ions to flow out of the cell. This results in the repolarization of the cell, restoring the resting membrane potential.

Title: Applications of Recombinant Human KCNA3 Protein

Recombinant Human KCNA3 Protein has various applications in both research and clinical settings. In research, this protein is used to study the role of potassium channels in various physiological processes. It is also used to investigate the effects of mutations in the KCNA3 gene, which have been associated with various neurological disorders.

In the clinical setting, Recombinant Human KCNA3 Protein is used as an antigen for diagnostic tests for autoimmune diseases such as multiple sclerosis and myasthenia gravis. These diseases are characterized by the production of autoantibodies against potassium channels, including KCNA3. By using Recombinant Human KCNA3 Protein as an antigen, these autoantibodies can be detected and used for diagnosis and monitoring of these diseases.

Title: Production of Recombinant Human KCNA3 Protein

Recombinant Human KCNA3 Protein is produced using recombinant DNA technology. The KCNA3 gene is cloned into a suitable expression vector and then introduced into host cells, such as bacteria or mammalian cells. The host cells then produce large quantities of the protein, which can be purified and used for various applications.

Title: Conclusion

In conclusion, Recombinant Human KCNA3 Protein is a crucial protein involved in regulating the electrical activity of cells. Its structure and activity make it an essential component in various physiological processes, and its applications in research and clinical settings make it a valuable tool in understanding and diagnosing diseases. With the advancement of recombinant DNA technology, the production of this protein has become more accessible, allowing for further research and development in this field.

Recombinant Human KCNA3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human KCNA3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products