Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KRT8/CK-8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P05787
Molecular weight:
40.65 kDa

Original price was: $315.00.Current price is: $274.00.

50ug 13% OFF + 274 loyalty points
Asp81–Ser410
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KRT8/CK-8 Protein, N-His

Product name ARO-P10901-100
Uniprot ID P05787
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMS
Molecular weight 40.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp81-Ser410
Aliases /Synonyms Type-II keratin Kb8, CYK8, Keratin-8, KRT8, Keratin, type II cytoskeletal 8, Cytokeratin-8, CK-8, K8
Reference ARO-P10901
Note For research use only.
Molecular Constructor
Asp81–Ser410
Product name ARO-P10901-1MG
Uniprot ID P05787
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMS
Molecular weight 40.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp81-Ser410
Aliases /Synonyms Type-II keratin Kb8, CYK8, Keratin-8, KRT8, Keratin, type II cytoskeletal 8, Cytokeratin-8, CK-8, K8
Reference ARO-P10901
Note For research use only.
Molecular Constructor
Asp81–Ser410
Product name ARO-P10901-50
Uniprot ID P05787
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMS
Molecular weight 40.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp81-Ser410
Aliases /Synonyms Type-II keratin Kb8, CYK8, Keratin-8, KRT8, Keratin, type II cytoskeletal 8, Cytokeratin-8, CK-8, K8
Reference ARO-P10901
Note For research use only.
Molecular Constructor
Asp81–Ser410

Introduction

Recombinant Human KRT8/CK-8 Protein, also known as Keratin 8 or Cytokeratin 8, is a type II intermediate filament protein that is encoded by the KRT8 gene in humans. It is a member of the cytokeratin family, which are proteins that make up the structural framework of epithelial cells. Recombinant Human KRT8/CK-8 Protein is a highly versatile protein that plays a crucial role in maintaining the structural integrity and function of epithelial tissues. In this article, we will explore the structure, activity, and applications of this important recombinant protein.

Structure of Recombinant Human KRT8/CK-8 Protein

Recombinant Human KRT8/CK-8 Protein is a 53.5 kDa protein that is composed of 483 amino acids. It has a characteristic rod-shaped structure, with a central alpha-helical domain flanked by non-helical head and tail domains. The alpha-helical domain is responsible for the formation of intermediate filaments, which are essential for maintaining the structural integrity of epithelial cells. The head and tail domains play a role in regulating the assembly and disassembly of intermediate filaments. The protein also contains several phosphorylation sites, which are important for its activity and function.

Activity of Recombinant Human KRT8/CK-8 Protein

Recombinant Human KRT8/CK-8 Protein is primarily expressed in simple epithelial cells, such as those found in the liver, pancreas, and gastrointestinal tract. It is involved in a variety of cellular processes, including cell signaling, cell migration, and cell proliferation. One of its main functions is to provide mechanical support and stability to epithelial cells, which are constantly exposed to mechanical stress. It also plays a role in maintaining the barrier function of epithelial tissues, preventing the entry of harmful substances and pathogens.

In addition, Recombinant Human KRT8/CK-8 Protein has been shown to have anti-apoptotic properties, protecting cells from programmed cell death. It also plays a role in regulating cellular metabolism and energy production. Dysregulation of Recombinant Human KRT8/CK-8 Protein has been linked to various diseases, including liver and pancreatic diseases, inflammatory bowel disease, and certain types of cancer.

Application of Recombinant Human KRT8/CK-8 Protein

The unique properties and functions of Recombinant Human KRT8/CK-8 Protein make it a valuable tool in various research and clinical applications. One of its main applications is in the study of epithelial cell biology and disease. Recombinant Human KRT8/CK-8 Protein can be used to investigate the role of intermediate filaments in maintaining epithelial cell structure and function. It can also be used to study the effects of mutations or dysregulation of this protein in various diseases.

In addition, Recombinant Human KRT8/CK-8 Protein has potential diagnostic and therapeutic applications. Its expression has been shown to be altered in certain diseases, making it a potential biomarker for disease diagnosis and monitoring. It has also been investigated as a potential therapeutic target for diseases such as cancer, where it may play a role in tumor growth and metastasis.

Moreover, Recombinant Human KRT8/CK-8 Protein has been used in the development of tissue engineering scaffolds for regenerative medicine. Its ability to provide mechanical support and promote cell adhesion makes it a promising candidate for the development of biomaterials for tissue repair and regeneration.

Conclusion

In conclusion, Recombinant Human KRT8/CK-8 Protein is a highly versatile protein with a crucial role in maintaining the structural integrity and function of epithelial tissues. Its unique structure and diverse functions make it a valuable tool in various research and clinical applications. Further studies on this protein may lead to a better understanding of its role in disease and the development of novel diagnostic and therapeutic strategies.

Recombinant Human KRT8/CK-8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human KRT8/CK-8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products