Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PLAGL2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UPG8
Molecular weight:
22.48 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Ser81–Thr251
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PLAGL2 Protein, N-His

Product name ARO-P12080-100
Uniprot ID Q9UPG8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKT
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser81-Thr251
Aliases /Synonyms KIAA0198, PLAGL2, Zinc finger protein PLAGL2, Pleiomorphic adenoma-like protein 2
Reference ARO-P12080
Note For research use only.
Molecular Constructor
Ser81–Thr251
Product name ARO-P12080-1MG
Uniprot ID Q9UPG8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKT
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser81-Thr251
Aliases /Synonyms KIAA0198, PLAGL2, Zinc finger protein PLAGL2, Pleiomorphic adenoma-like protein 2
Reference ARO-P12080
Note For research use only.
Molecular Constructor
Ser81–Thr251
Product name ARO-P12080-50
Uniprot ID Q9UPG8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKT
Molecular weight 22.48 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser81-Thr251
Aliases /Synonyms KIAA0198, PLAGL2, Zinc finger protein PLAGL2, Pleiomorphic adenoma-like protein 2
Reference ARO-P12080
Note For research use only.
Molecular Constructor
Ser81–Thr251

Introduction to Recombinant Human PLAGL2 Protein

Recombinant Human PLAGL2 Protein, also known as pleomorphic adenoma gene-like 2 protein, is a member of the PLAG family of zinc finger transcription factors. It is encoded by the PLAGL2 gene located on chromosome 20q11.2. PLAGL2 plays a crucial role in regulating cellular processes such as proliferation, differentiation, and apoptosis. It is highly expressed in various tissues and has been found to be dysregulated in several types of cancer, making it an important target for research and therapeutic development.

Structure of Recombinant Human PLAGL2 Protein

Recombinant Human PLAGL2 Protein is a 72 kDa protein consisting of 621 amino acids. It contains six C2H2-type zinc fingers, which are responsible for DNA binding and transcriptional regulation. These zinc fingers are arranged in a modular fashion, with three fingers in the N-terminal region and three in the C-terminal region. This unique structure allows PLAGL2 to bind to specific DNA sequences and regulate gene expression.

Activity of Recombinant Human PLAGL2 Protein

Recombinant Human PLAGL2 Protein has been shown to have both transcriptional activation and repression activity. It acts as a transcription factor by binding to specific DNA sequences and regulating the expression of target genes. PLAGL2 has been found to regulate the expression of genes involved in cell cycle progression, apoptosis, and differentiation. It also interacts with other proteins to form transcriptional complexes, further modulating its activity.

Recent studies have also shown that PLAGL2 has non-transcriptional functions, such as promoting cell migration and invasion. This activity is mediated by the interaction of PLAGL2 with other proteins involved in cytoskeletal organization and cell adhesion. These non-transcriptional functions of PLAGL2 have been implicated in cancer progression and metastasis.

Application of Recombinant Human PLAGL2 Protein

Recombinant Human PLAGL2 Protein has been widely used in research to study its role in various cellular processes and diseases. It is also being explored as a potential therapeutic target for cancer treatment. Recombinant PLAGL2 protein can be produced in large quantities using recombinant DNA technology, making it easily accessible for research purposes.

One of the major applications of Recombinant Human PLAGL2 Protein is in cancer research. PLAGL2 has been found to be overexpressed in several types of cancer, including breast, lung, and colon cancer. It has been shown to promote tumor growth and metastasis by regulating the expression of genes involved in these processes. Targeting PLAGL2 with specific inhibitors or by silencing its expression has shown promising results in inhibiting cancer growth and metastasis in preclinical studies.

In addition to cancer research, Recombinant Human PLAGL2 Protein has also been studied in other diseases such as diabetes and neurodegenerative disorders. PLAGL2 has been found to play a role in regulating insulin secretion and glucose metabolism, making it a potential target for diabetes treatment. It has also been linked to the development of neurodegenerative diseases such as Alzheimer’s and Parkinson’s, and further research is being conducted to understand its role in these conditions.

In conclusion, Recombinant Human PLAGL2 Protein is a crucial protein involved in regulating various cellular processes and has been implicated in several diseases. Its unique structure and activity make it an important target for research and therapeutic development. Further studies on PLAGL2 are needed to fully understand its function and potential applications in various diseases.

Recombinant Human PLAGL2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PLAGL2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products