Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PTGES3/P23 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15185
Molecular weight:
20.86 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Met1–Glu160
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PTGES3/P23 Protein, N-His

Product name ARO-P11928-100
Uniprot ID Q15185
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Molecular weight 20.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu160
Aliases /Synonyms PTGES3, Hsp90 co-chaperone, P23, Progesterone receptor complex p23, Prostaglandin E synthase 3, cPGES, Telomerase-binding protein p23, Cytosolic prostaglandin E2 synthase, TEBP
Reference ARO-P11928
Note For research use only.
Molecular Constructor
Met1–Glu160
Product name ARO-P11928-1MG
Uniprot ID Q15185
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Molecular weight 20.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu160
Aliases /Synonyms PTGES3, Hsp90 co-chaperone, P23, Progesterone receptor complex p23, Prostaglandin E synthase 3, cPGES, Telomerase-binding protein p23, Cytosolic prostaglandin E2 synthase, TEBP
Reference ARO-P11928
Note For research use only.
Molecular Constructor
Met1–Glu160
Product name ARO-P11928-50
Uniprot ID Q15185
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Molecular weight 20.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Glu160
Aliases /Synonyms PTGES3, Hsp90 co-chaperone, P23, Progesterone receptor complex p23, Prostaglandin E synthase 3, cPGES, Telomerase-binding protein p23, Cytosolic prostaglandin E2 synthase, TEBP
Reference ARO-P11928
Note For research use only.
Molecular Constructor
Met1–Glu160

Introduction

Recombinant Human PTGES3/P23 Protein is a synthetic version of the human PTGES3/P23 protein, which is also known as prostaglandin E synthase 3. This protein is involved in the production of prostaglandin E2 (PGE2), a key mediator of inflammation and pain. Recombinant Human PTGES3/P23 Protein has been extensively studied for its structure, activity, and potential applications in various medical fields.

Structure of Recombinant Human PTGES3/P23 Protein

Recombinant Human PTGES3/P23 Protein is a 23 kDa protein composed of 199 amino acids. It has a conserved catalytic domain and a C-terminal membrane-binding domain. The protein also contains a heme-binding motif, which is essential for its enzymatic activity. Recombinant Human PTGES3/P23 Protein is produced using recombinant DNA technology, where the gene encoding the protein is inserted into a suitable expression vector and expressed in a host cell, typically E. coli.

Activity of Recombinant Human PTGES3/P23 Protein

Recombinant Human PTGES3/P23 Protein is a member of the membrane-associated proteins in eicosanoid and glutathione metabolism (MAPEG) family. It acts as a glutathione-dependent PGE2 synthase, catalyzing the conversion of prostaglandin H2 (PGH2) to PGE2. This reaction is crucial in the inflammatory response, as PGE2 is a potent pro-inflammatory mediator that promotes vasodilation, pain, and fever. Recombinant Human PTGES3/P23 Protein has been shown to have a high affinity for PGH2, making it a key enzyme in the production of PGE2.

Applications of Recombinant Human PTGES3/P23 Protein

The potential applications of Recombinant Human PTGES3/P23 Protein are vast, given its role in the inflammatory response. One potential application is in the treatment of inflammatory diseases such as rheumatoid arthritis, osteoarthritis, and asthma. Studies have shown that inhibiting the activity of PTGES3/P23 can reduce the production of PGE2 and alleviate symptoms of inflammation.

In addition to its role in inflammation, Recombinant Human PTGES3/P23 Protein has also been studied for its potential in cancer therapy. PGE2 has been shown to promote tumor growth and metastasis, and inhibiting its production with Recombinant Human PTGES3/P23 Protein could potentially slow down cancer progression.

Another potential application of Recombinant Human PTGES3/P23 Protein is in the development of pain-relieving drugs. PGE2 is a key mediator of pain, and targeting PTGES3/P23 could provide a new avenue for pain management. Recombinant Human PTGES3/P23 Protein has also been studied for its potential in the treatment of neurological disorders such as Alzheimer’s disease and Parkinson’s disease, as PGE2 has been linked to neuroinflammation and neuronal death.

Conclusion

In summary, Recombinant Human PTGES3/P23 Protein is a synthetic version of the human PTGES3/P23 protein that plays a crucial role in the production of PGE2, a potent pro-inflammatory mediator. Its structure, activity, and potential applications have been extensively studied, and it shows promise in the treatment of inflammatory diseases, cancer, pain, and neurological disorders. Further research and development of Recombinant Human PTGES3/P23 Protein could lead to new and effective treatments for these conditions.

Recombinant Human PTGES3/P23 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PTGES3/P23 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products