Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PTTG1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95997
Molecular weight:
20.19 kDa

Original price was: $320.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
Asn121–Asp190
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PTTG1 Protein, N-His-SUMO

Product name ARO-P11297-100
Uniprot ID O95997
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLD
Molecular weight 20.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn121-Asp190
Aliases /Synonyms PTTG1, Esp1-associated protein, EAP1, Securin, TUTR1, PTTG, hPTTG, Pituitary tumor-transforming gene 1 protein, Tumor-transforming protein 1
Reference ARO-P11297
Note For research use only.
Molecular Constructor
Asn121–Asp190
Product name ARO-P11297-1MG
Uniprot ID O95997
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLD
Molecular weight 20.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn121-Asp190
Aliases /Synonyms PTTG1, Esp1-associated protein, EAP1, Securin, TUTR1, PTTG, hPTTG, Pituitary tumor-transforming gene 1 protein, Tumor-transforming protein 1
Reference ARO-P11297
Note For research use only.
Molecular Constructor
Asn121–Asp190
Product name ARO-P11297-50
Uniprot ID O95997
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPLDFESFDLPEEHQIAHLPLSGVPLMILDEERELEKLFQLGPPSPVKMPSPPWESNLLQSPSSILSTLD
Molecular weight 20.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn121-Asp190
Aliases /Synonyms PTTG1, Esp1-associated protein, EAP1, Securin, TUTR1, PTTG, hPTTG, Pituitary tumor-transforming gene 1 protein, Tumor-transforming protein 1
Reference ARO-P11297
Note For research use only.
Molecular Constructor
Asn121–Asp190

Introduction to Recombinant Human PTTG1 Protein

Recombinant Human PTTG1 Protein, also known as pituitary tumor-transforming gene 1 protein, is a highly conserved protein that plays a crucial role in cell cycle regulation and tumorigenesis. It is encoded by the PTTG1 gene and is expressed in various tissues including the pituitary gland, testis, and brain. Recombinant Human PTTG1 Protein has been extensively studied for its structure, activity, and potential applications in both research and therapeutic settings. In this article, we will provide a detailed scientific description of this protein.

Structure of Recombinant Human PTTG1 Protein

Recombinant Human PTTG1 Protein is a 22 kDa protein consisting of 202 amino acids. It contains a highly conserved N-terminal domain, a central proline-rich domain, and a C-terminal domain with a PTTG1-specific sequence. The protein also has several phosphorylation sites, which play a role in its activity and regulation. Recombinant Human PTTG1 Protein has been shown to form homodimers, which are essential for its function.

Activity of Recombinant Human PTTG1 Protein

Recombinant Human PTTG1 Protein is a multifunctional protein with diverse activities. It is primarily known for its role in regulating the cell cycle by promoting cell proliferation and inhibiting apoptosis. This is achieved through its interaction with various cell cycle regulators, including cyclin B1, p53, and p21. Recombinant Human PTTG1 Protein also plays a crucial role in DNA repair and maintenance of genomic stability. Additionally, it has been shown to promote angiogenesis, which is the formation of new blood vessels, and is involved in the development of various cancers.

Application of Recombinant Human PTTG1 Protein

Due to its important role in cell cycle regulation and tumorigenesis, Recombinant Human PTTG1 Protein has several potential applications in both research and therapeutic settings. One of the most promising applications is its use as a biomarker for cancer diagnosis and prognosis. Studies have shown that increased expression of PTTG1 is associated with various types of cancers, including pituitary, breast, and lung cancer. Therefore, measuring the levels of PTTG1 in patient samples could aid in early detection and monitoring of cancer progression.

Furthermore, Recombinant Human PTTG1 Protein has been investigated as a potential therapeutic target for cancer treatment. Inhibiting its activity has been shown to suppress tumor growth and induce cell death in cancer cells. This makes it a promising target for the development of novel anti-cancer drugs.

In addition to cancer, Recombinant Human PTTG1 Protein has also been studied for its role in other diseases. It has been implicated in the development of endometriosis, a condition where the tissue that lines the uterus grows outside of it. Therefore, targeting PTTG1 could potentially provide a new treatment option for this disease.

Another potential application of Recombinant Human PTTG1 Protein is in fertility treatment. Studies have shown that PTTG1 is involved in the regulation of sperm motility and fertilization. Therefore, it could be used as a diagnostic marker for male infertility and as a potential target for the development of male contraceptives.

Conclusion

In summary, Recombinant Human PTTG1 Protein is a highly conserved protein with diverse activities. Its role in cell cycle regulation and tumorigenesis makes it a promising biomarker and therapeutic target for various diseases, particularly cancer. Further research on this protein could lead to the development of new diagnostic tools and treatments for a wide range of diseases.

Recombinant Human PTTG1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human PTTG1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products