Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RARG Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P13631
Molecular weight:
30.15 kDa

Original price was: $309.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Asp178–Glu423
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RARG Protein, N-His

Product name ARO-P10799-100
Uniprot ID P13631
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFE
Molecular weight 30.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp178-Glu423
Aliases /Synonyms RAR-gamma, Nuclear receptor subfamily 1 group B member 3, NR1B3, Retinoic acid receptor gamma, RARG
Reference ARO-P10799
Note For research use only.
Molecular Constructor
Asp178–Glu423
Product name ARO-P10799-1MG
Uniprot ID P13631
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFE
Molecular weight 30.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp178-Glu423
Aliases /Synonyms RAR-gamma, Nuclear receptor subfamily 1 group B member 3, NR1B3, Retinoic acid receptor gamma, RARG
Reference ARO-P10799
Note For research use only.
Molecular Constructor
Asp178–Glu423
Product name ARO-P10799-50
Uniprot ID P13631
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFE
Molecular weight 30.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp178-Glu423
Aliases /Synonyms RAR-gamma, Nuclear receptor subfamily 1 group B member 3, NR1B3, Retinoic acid receptor gamma, RARG
Reference ARO-P10799
Note For research use only.
Molecular Constructor
Asp178–Glu423

Introduction to Recombinant Human RARG Protein

Recombinant Human RARG Protein is a type of protein that is produced through genetic engineering techniques. It is a member of the retinoic acid receptor (RAR) family and is involved in various cellular processes such as cell growth, differentiation, and development. This protein is highly expressed in tissues such as the liver, kidney, and adipose tissue, and has been found to have important roles in regulating gene expression and signaling pathways.

Structure of Recombinant Human RARG Protein

The structure of Recombinant Human RARG Protein is composed of 462 amino acids and has a molecular weight of approximately 52 kDa. It belongs to the nuclear receptor superfamily and has a characteristic structure consisting of three domains: the N-terminal domain (A/B), the DNA-binding domain (C), and the ligand-binding domain (D/E). The N-terminal domain is responsible for transcriptional activation, while the DNA-binding domain allows the protein to bind to specific DNA sequences. The ligand-binding domain is responsible for binding to retinoic acid, which is the natural ligand for RARG.

Activity of Recombinant Human RARG Protein

Recombinant Human RARG Protein is a transcription factor that regulates gene expression by binding to specific DNA sequences called retinoic acid response elements (RAREs). Upon binding to retinoic acid, RARG undergoes a conformational change, allowing it to recruit co-activators or co-repressors, which then modulate the expression of target genes. This protein has been found to be involved in various cellular processes, including cell differentiation, proliferation, and apoptosis. Additionally, RARG has also been shown to play a role in metabolism and energy homeostasis, making it a potential target for therapeutic interventions.

Application of Recombinant Human RARG Protein

The application of Recombinant Human RARG Protein in research and medicine has been extensive. One of the main uses of this protein is in studying the mechanisms of gene regulation and transcriptional control. By using recombinant RARG, researchers can manipulate its expression and activity to understand its role in various cellular processes. This has led to a better understanding of diseases such as cancer, where dysregulation of RARG has been implicated in tumor growth and progression.

Moreover, Recombinant Human RARG Protein has also been used in drug discovery and development. As RARG is involved in various cellular processes, it has been identified as a potential therapeutic target for diseases such as obesity, diabetes, and neurodegenerative disorders. By studying the structure and activity of recombinant RARG, researchers can design and develop drugs that specifically target this protein, leading to more effective and targeted treatments.

Antigenic Properties of Recombinant Human RARG Protein

As a recombinant protein, Recombinant Human RARG Protein has been found to be highly antigenic. This means that it can stimulate the production of antibodies in the body, making it a useful tool in immunological studies. For example, recombinant RARG can be used as an antigen in the production of monoclonal antibodies, which can then be used for various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISA).

In summary, Recombinant Human RARG Protein is a crucial protein in regulating gene expression and cellular processes. Its structure, activity, and antigenic properties make it a valuable tool in research and medicine, with potential applications in drug discovery and development. As our understanding of this protein continues to grow, so does its potential for future therapeutic interventions.

Recombinant Human RARG Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RARG Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products