Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RPS8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P62241
Molecular weight:
21.80 kDa

Original price was: $318.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
Arg41–Lys208
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RPS8 Protein, N-His

Product name ARO-P10762-100
Uniprot ID P62241
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLRKIKARKGK
Molecular weight 21.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg41-Lys208
Aliases /Synonyms RPS8, Small ribosomal subunit protein eS8, 40S ribosomal protein S8
Reference ARO-P10762
Note For research use only.
Molecular Constructor
Arg41–Lys208
Product name ARO-P10762-1MG
Uniprot ID P62241
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLRKIKARKGK
Molecular weight 21.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg41-Lys208
Aliases /Synonyms RPS8, Small ribosomal subunit protein eS8, 40S ribosomal protein S8
Reference ARO-P10762
Note For research use only.
Molecular Constructor
Arg41–Lys208
Product name ARO-P10762-50
Uniprot ID P62241
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLRKIKARKGK
Molecular weight 21.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg41-Lys208
Aliases /Synonyms RPS8, Small ribosomal subunit protein eS8, 40S ribosomal protein S8
Reference ARO-P10762
Note For research use only.
Molecular Constructor
Arg41–Lys208

Introduction

Recombinant Human RPS8 Protein, also known as ribosomal protein S8, is a protein that plays a crucial role in protein synthesis. It is a highly conserved protein found in both prokaryotes and eukaryotes, and has been extensively studied for its structure, activity, and potential applications.

Structure of Recombinant Human RPS8 Protein

The Recombinant Human RPS8 Protein is composed of 167 amino acids, with a molecular weight of approximately 19 kDa. It is a small subunit of the ribosome, and is responsible for binding to the messenger RNA (mRNA) during translation. The protein has a characteristic “S8” domain, which is highly conserved across different species.

Studies have shown that Recombinant Human RPS8 Protein has a unique structure, with two alpha helices and five beta strands arranged in a beta-barrel formation. This structure is essential for the protein’s function in binding to the ribosomal RNA (rRNA) and mRNA, and facilitating the assembly of the ribosome.

Activity of Recombinant Human RPS8 Protein

The primary function of Recombinant Human RPS8 Protein is to participate in the translation process, where it helps in the formation of the ribosome-mRNA complex. This complex is crucial for the accurate and efficient translation of genetic information into proteins.

In addition to its role in protein synthesis, Recombinant Human RPS8 Protein has also been found to have other activities. Studies have shown that it can interact with various proteins involved in cell growth and proliferation, suggesting its potential involvement in cell signaling pathways.

Moreover, Recombinant Human RPS8 Protein has been shown to have a role in the regulation of gene expression. It has been found to bind to specific regions of DNA, influencing the expression of certain genes. This activity highlights the diverse functions of this protein beyond its traditional role in translation.

Application of Recombinant Human RPS8 Protein

The unique structure and activity of Recombinant Human RPS8 Protein make it a valuable tool in various scientific fields. One of its primary applications is in the study of protein synthesis and translation. Recombinant Human RPS8 Protein can be used in in vitro translation assays to investigate the mechanisms of protein synthesis and the role of different factors in this process.

Furthermore, Recombinant Human RPS8 Protein has potential applications in the development of new antibiotics. As it is highly conserved and essential for protein synthesis, targeting this protein could lead to the inhibition of bacterial growth and survival.

In the field of cancer research, Recombinant Human RPS8 Protein has been found to be overexpressed in certain types of cancer cells, making it a potential biomarker for cancer diagnosis and treatment. Additionally, its involvement in cell signaling pathways suggests its potential as a therapeutic target for cancer treatment.

Conclusion

In conclusion, Recombinant Human RPS8 Protein is a vital protein involved in protein synthesis and has diverse functions beyond its traditional role. Its unique structure and activity make it a valuable tool in various scientific fields, including protein synthesis studies, antibiotic development, and cancer research. Further research on this protein could lead to a better understanding of its functions and potential applications in the future.

Recombinant Human RPS8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RPS8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products