Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human SH3PXD2A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5TCZ1
Molecular weight:
17.51 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Met1–Asn129
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human SH3PXD2A Protein, N-His

Recombinant Human SH3PXD2A Protein, N-His

Product name ARO-P12265-100
Uniprot ID Q5TCZ1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MLAYCVQDATVVDVEKRRNPSKHYVYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPIEGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLKPIDEYCRALVRLPPHISQCDEVFRFFEARPEDVN
Molecular weight 17.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn129
Aliases /Synonyms KIAA0418, Tyrosine kinase substrate with five SH3 domains, TKS5, SH3 multiple domains protein 1, SH3PXD2A, SH3MD1, SH3 and PX domain-containing protein 2A, Five SH3 domain-containing protein, Adapter protein TKS5, FISH
Reference ARO-P12265
Note For research use only.
Molecular Constructor
Met1–Asn129
Product name ARO-P12265-1MG
Uniprot ID Q5TCZ1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MLAYCVQDATVVDVEKRRNPSKHYVYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPIEGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLKPIDEYCRALVRLPPHISQCDEVFRFFEARPEDVN
Molecular weight 17.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn129
Aliases /Synonyms KIAA0418, Tyrosine kinase substrate with five SH3 domains, TKS5, SH3 multiple domains protein 1, SH3PXD2A, SH3MD1, SH3 and PX domain-containing protein 2A, Five SH3 domain-containing protein, Adapter protein TKS5, FISH
Reference ARO-P12265
Note For research use only.
Molecular Constructor
Met1–Asn129
Product name ARO-P12265-50
Uniprot ID Q5TCZ1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MLAYCVQDATVVDVEKRRNPSKHYVYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPIEGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLKPIDEYCRALVRLPPHISQCDEVFRFFEARPEDVN
Molecular weight 17.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn129
Aliases /Synonyms KIAA0418, Tyrosine kinase substrate with five SH3 domains, TKS5, SH3 multiple domains protein 1, SH3PXD2A, SH3MD1, SH3 and PX domain-containing protein 2A, Five SH3 domain-containing protein, Adapter protein TKS5, FISH
Reference ARO-P12265
Note For research use only.
Molecular Constructor
Met1–Asn129

Recombinant Human SH3PXD2A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SH3PXD2A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products