Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SMARCC1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92922
Molecular weight:
30.16 kDa

Original price was: $278.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Thr40–Asn277
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SMARCC1 Protein, N-His

Product name ARO-P12028-100
Uniprot ID Q92922
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFN
Molecular weight 30.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Asn277
Aliases /Synonyms SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1, SWI/SNF complex subunit SMARCC1, BAF155, SMARCC1, BRG1-associated factor 155, SWI/SNF complex 155 kDa subunit
Reference ARO-P12028
Note For research use only.
Molecular Constructor
Thr40–Asn277
Product name ARO-P12028-1MG
Uniprot ID Q92922
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFN
Molecular weight 30.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Asn277
Aliases /Synonyms SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1, SWI/SNF complex subunit SMARCC1, BAF155, SMARCC1, BRG1-associated factor 155, SWI/SNF complex 155 kDa subunit
Reference ARO-P12028
Note For research use only.
Molecular Constructor
Thr40–Asn277
Product name ARO-P12028-50
Uniprot ID Q92922
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFN
Molecular weight 30.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr40-Asn277
Aliases /Synonyms SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1, SWI/SNF complex subunit SMARCC1, BAF155, SMARCC1, BRG1-associated factor 155, SWI/SNF complex 155 kDa subunit
Reference ARO-P12028
Note For research use only.
Molecular Constructor
Thr40–Asn277

Introduction to Recombinant Human SMARCC1 Protein

Recombinant Human SMARCC1 Protein, also known as SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1, is a crucial component of the SWI/SNF chromatin remodeling complex. This protein plays a vital role in regulating gene expression by altering the structure of chromatin, the complex of DNA and proteins that make up the genetic material in the nucleus of a cell. The recombinant form of this protein is produced through genetic engineering techniques and has a wide range of applications in various fields of research, including cancer biology, developmental biology, and epigenetics.

Structure of Recombinant Human SMARCC1 Protein

The recombinant form of SMARCC1 protein is a 110 kDa protein consisting of 982 amino acids. It contains a conserved ATPase domain, a bromodomain, and a helicase/SANT-associated (HSA) domain. The ATPase domain is responsible for the ATP-dependent chromatin remodeling activity of the protein, while the bromodomain is involved in recognizing and binding to acetylated histones, a key event in chromatin remodeling. The HSA domain interacts with other components of the SWI/SNF complex and is crucial for the proper functioning of the complex.

The recombinant protein is produced in a mammalian expression system, ensuring proper folding and post-translational modifications, such as phosphorylation and acetylation, which are essential for its activity. It is then purified using various chromatography techniques to obtain a highly pure and active form of the protein.

Activity of Recombinant Human SMARCC1 Protein

The primary function of SMARCC1 protein is to regulate gene expression by altering the structure of chromatin. This is achieved through its ATP-dependent chromatin remodeling activity, which involves the use of energy from ATP hydrolysis to disrupt the interactions between DNA and histones, allowing for the repositioning of nucleosomes and exposing DNA for transcriptional machinery to access.

In addition to its role in chromatin remodeling, SMARCC1 has been shown to interact with other proteins and play a role in various cellular processes. It has been implicated in DNA repair, cell cycle regulation, and cell differentiation. Studies have also shown that SMARCC1 is involved in the regulation of gene expression during embryonic development, highlighting its importance in early developmental processes.

Applications of Recombinant Human SMARCC1 Protein

The recombinant form of SMARCC1 protein has a wide range of applications in research, particularly in the fields of cancer biology, developmental biology, and epigenetics. Its role in chromatin remodeling makes it a crucial tool for studying the mechanisms of gene regulation and its dysregulation in diseases such as cancer. The recombinant protein can be used to investigate the role of SMARCC1 in various cellular processes and its potential as a therapeutic target.

Furthermore, the recombinant protein can be used in in vitro assays to study its chromatin remodeling activity and its interactions with other proteins. It can also be used in structural studies to understand the mechanisms of action of SMARCC1 and its role in the SWI/SNF complex.

Conclusion

In summary, Recombinant Human SMARCC1 Protein is an essential component of the SWI/SNF chromatin remodeling complex and plays a crucial role in regulating gene expression. Its recombinant form is produced through genetic engineering techniques and has a wide range of applications in research. Its structure, activity, and applications make it a valuable tool for studying gene regulation and its dysregulation in diseases, providing valuable insights into the complex mechanisms of cellular processes.

Recombinant Human SMARCC1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SMARCC1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products