Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TMED10 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P49755
Molecular weight:
23.66 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Ile32–Lys133
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TMED10 Protein, N-His-SUMO

Product name ARO-P12106-100
Uniprot ID P49755
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAK
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile32-Lys133
Aliases /Synonyms S31I125, Tmp-21-I, Transmembrane protein Tmp21, Transmembrane emp24 domain-containing protein 10, TMP21, TMED10, 21 kDa transmembrane-trafficking protein, p23, S31III125, Protein TMED10, p24delta1, p24 family protein delta-1, p24delta
Reference ARO-P12106
Note For research use only.
Molecular Constructor
Ile32–Lys133
Product name ARO-P12106-1MG
Uniprot ID P49755
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAK
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile32-Lys133
Aliases /Synonyms S31I125, Tmp-21-I, Transmembrane protein Tmp21, Transmembrane emp24 domain-containing protein 10, TMP21, TMED10, 21 kDa transmembrane-trafficking protein, p23, S31III125, Protein TMED10, p24delta1, p24 family protein delta-1, p24delta
Reference ARO-P12106
Note For research use only.
Molecular Constructor
Ile32–Lys133
Product name ARO-P12106-50
Uniprot ID P49755
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAK
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile32-Lys133
Aliases /Synonyms S31I125, Tmp-21-I, Transmembrane protein Tmp21, Transmembrane emp24 domain-containing protein 10, TMP21, TMED10, 21 kDa transmembrane-trafficking protein, p23, S31III125, Protein TMED10, p24delta1, p24 family protein delta-1, p24delta
Reference ARO-P12106
Note For research use only.
Molecular Constructor
Ile32–Lys133

Recombinant Human TMED10 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human TMED10 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products