Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human TRIM13 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O60858
Molecular weight:
19.39 kDa

Original price was: $497.00.Current price is: $392.00.

100ug 21% OFF + 392 loyalty points
Met1–Arg153
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human TRIM13 Protein, N-His

Recombinant Human TRIM13 Protein, N-His

Product name ARO-P10087-100
Uniprot ID O60858
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATRGEHTKHVFCSIEDAYAQERDAFESLFQSFETWR
Molecular weight 19.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg153
Aliases /Synonyms E3 ubiquitin-protein ligase TRIM13, 2.3.2.27, B-cell chronic lymphocytic leukemia tumor suppressor Leu5, Leukemia-associated protein 5, Putative tumor suppressor RFP2, RING finger protein 77, RING-type E3 ubiquitin transferase TRIM13, Ret finger protein 2, Tripartite motif-containing protein 13, TRIM13, LEU5, RFP2, RNF77
Reference ARO-P10087
Note For research use only.
Molecular Constructor
Met1–Arg153
Product name ARO-P10087-1MG
Uniprot ID O60858
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATRGEHTKHVFCSIEDAYAQERDAFESLFQSFETWR
Molecular weight 19.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg153
Aliases /Synonyms E3 ubiquitin-protein ligase TRIM13, 2.3.2.27, B-cell chronic lymphocytic leukemia tumor suppressor Leu5, Leukemia-associated protein 5, Putative tumor suppressor RFP2, RING finger protein 77, RING-type E3 ubiquitin transferase TRIM13, Ret finger protein 2, Tripartite motif-containing protein 13, TRIM13, LEU5, RFP2, RNF77
Reference ARO-P10087
Note For research use only.
Molecular Constructor
Met1–Arg153
Product name ARO-P10087-50
Uniprot ID O60858
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATRGEHTKHVFCSIEDAYAQERDAFESLFQSFETWR
Molecular weight 19.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg153
Aliases /Synonyms E3 ubiquitin-protein ligase TRIM13, 2.3.2.27, B-cell chronic lymphocytic leukemia tumor suppressor Leu5, Leukemia-associated protein 5, Putative tumor suppressor RFP2, RING finger protein 77, RING-type E3 ubiquitin transferase TRIM13, Ret finger protein 2, Tripartite motif-containing protein 13, TRIM13, LEU5, RFP2, RNF77
Reference ARO-P10087
Note For research use only.
Molecular Constructor
Met1–Arg153

There are no reviews yet.

Be the first to review “Recombinant Human TRIM13 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products