Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRIM33/TIF1-γ Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UPN9
Molecular weight:
26.01 kDa

Original price was: $406.00.Current price is: $327.00.

100ug 19% OFF + 327 loyalty points
Asp882–Ala1087
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRIM33/TIF1-γ Protein, N-His

Product name ARO-P12642-100
Uniprot ID Q9UPN9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA
Molecular weight 26.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp882-Ala1087
Aliases /Synonyms TRIM33, RFG7, KIAA1113, RET-fused gene 7 protein, Tripartite motif-containing protein 33, RING-type E3 ubiquitin transferase TRIM33, E3 ubiquitin-protein ligase TRIM33, Protein Rfg7, TIF1-gamma, Ectodermin homolog, TIF1G, Transcription intermediary factor 1-gamma
Reference ARO-P12642
Note For research use only.
Molecular Constructor
Asp882–Ala1087
Product name ARO-P12642-1MG
Uniprot ID Q9UPN9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA
Molecular weight 26.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp882-Ala1087
Aliases /Synonyms TRIM33, RFG7, KIAA1113, RET-fused gene 7 protein, Tripartite motif-containing protein 33, RING-type E3 ubiquitin transferase TRIM33, E3 ubiquitin-protein ligase TRIM33, Protein Rfg7, TIF1-gamma, Ectodermin homolog, TIF1G, Transcription intermediary factor 1-gamma
Reference ARO-P12642
Note For research use only.
Molecular Constructor
Asp882–Ala1087
Product name ARO-P12642-50
Uniprot ID Q9UPN9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DDDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFA
Molecular weight 26.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp882-Ala1087
Aliases /Synonyms TRIM33, RFG7, KIAA1113, RET-fused gene 7 protein, Tripartite motif-containing protein 33, RING-type E3 ubiquitin transferase TRIM33, E3 ubiquitin-protein ligase TRIM33, Protein Rfg7, TIF1-gamma, Ectodermin homolog, TIF1G, Transcription intermediary factor 1-gamma
Reference ARO-P12642
Note For research use only.
Molecular Constructor
Asp882–Ala1087

Recombinant Human TRIM33/TIF1-γ Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TRIM33/TIF1-γ Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products