Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CCL28/MEC Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9JIL2
Molecular weight:
8.89 kDa

Original price was: $315.00.Current price is: $274.00.

50ug 13% OFF + 274 loyalty points
His37–Gly94
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CCL28/MEC Protein, N-His

Product name ARO-P11110-100
Uniprot ID Q9JIL2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNG
Molecular weight 8.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His37-Gly94
Aliases /Synonyms Scya28, C-C motif chemokine 28, Small-inducible cytokine A28, Ccl28
Reference ARO-P11110
Note For research use only.
Molecular Constructor
His37–Gly94
Product name ARO-P11110-1MG
Uniprot ID Q9JIL2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNG
Molecular weight 8.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His37-Gly94
Aliases /Synonyms Scya28, C-C motif chemokine 28, Small-inducible cytokine A28, Ccl28
Reference ARO-P11110
Note For research use only.
Molecular Constructor
His37–Gly94
Product name ARO-P11110-50
Uniprot ID Q9JIL2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNG
Molecular weight 8.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His37-Gly94
Aliases /Synonyms Scya28, C-C motif chemokine 28, Small-inducible cytokine A28, Ccl28
Reference ARO-P11110
Note For research use only.
Molecular Constructor
His37–Gly94

Introduction

Recombinant Mouse CCL28/MEC protein is a highly versatile and potent chemokine that plays a crucial role in the immune system. This protein is produced through recombinant DNA technology, making it a valuable tool for various scientific applications. In this article, we will explore the structure, activity, and applications of Recombinant Mouse CCL28/MEC protein.

Structure of Recombinant Mouse CCL28/MEC Protein

Recombinant Mouse CCL28/MEC protein is a small protein consisting of 121 amino acids. It belongs to the CC chemokine family and is also known as mucosae-associated epithelial chemokine (MEC). The protein has a molecular weight of approximately 13 kDa and contains four cysteine residues that form two disulfide bonds, giving it a characteristic CC motif. The protein also has a conserved N-terminal region and a flexible C-terminal region.

Activity of Recombinant Mouse CCL28/MEC Protein

Recombinant Mouse CCL28/MEC protein acts as a chemoattractant for various immune cells, including T cells, B cells, and dendritic cells. It binds to the chemokine receptor CCR10, which is expressed on the surface of these cells. This binding triggers a signaling cascade that leads to the migration of immune cells to sites of inflammation or infection.

Apart from its chemotactic activity, Recombinant Mouse CCL28/MEC protein also has antimicrobial properties. It can directly kill bacteria and fungi by disrupting their cell membranes. This protein is highly expressed in mucosal tissues, such as the gastrointestinal and respiratory tracts, where it acts as the first line of defense against invading pathogens.

Applications of Recombinant Mouse CCL28/MEC Protein

The unique structure and activity of Recombinant Mouse CCL28/MEC protein make it a valuable tool for various scientific applications. Some of its key applications are:

1. Research Tool

Recombinant Mouse CCL28/MEC protein is widely used as a research tool to study the role of chemokines in the immune system. Its ability to attract and activate immune cells makes it a valuable tool for investigating various immune responses, such as inflammation, infection, and cancer.

2. Vaccine Adjuvant

The chemotactic and antimicrobial properties of Recombinant Mouse CCL28/MEC protein make it an ideal candidate for use as a vaccine adjuvant. Adjuvants are substances that enhance the immune response to a vaccine. By attracting immune cells to the site of vaccination and activating them, Recombinant Mouse CCL28/MEC protein can improve the efficacy of vaccines.

3. Therapeutic Agent

Recombinant Mouse CCL28/MEC protein has shown promising results in preclinical studies as a potential therapeutic agent for various diseases. Its ability to attract immune cells to specific sites and its antimicrobial properties make it a potential candidate for the treatment of infections, inflammatory diseases, and cancer.

4. Diagnostic Marker

The expression of Recombinant Mouse CCL28/MEC protein is upregulated in various diseases, making it a potential diagnostic marker. By measuring the levels of this protein in biological samples, researchers can identify and monitor the progression of diseases such as inflammatory bowel disease, asthma, and various cancers.

Conclusion

Recombinant Mouse CCL28/MEC protein is a highly versatile and potent chemokine with a unique structure and activity. Its ability to attract and activate immune cells, as well as its antimicrobial properties, make it a valuable tool for various scientific applications. From research to therapeutics, this protein has the potential to make a significant impact in the field of immunology.

Recombinant Mouse CCL28/MEC Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CCL28/MEC Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products