Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD267/TNFRSF13B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9ET35
Molecular weight:
11.30 kDa

Original price was: $353.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Met1–Arg79
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD267/TNFRSF13B Protein, N-His

Product name ARO-P10464-100
Uniprot ID Q9ET35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MAMAFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKR
Molecular weight 11.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg79
Aliases /Synonyms CD267, Transmembrane activator and CAML interactor, Tumor necrosis factor receptor superfamily member 13B, TNFRSF13B, TACI
Reference ARO-P10464
Note For research use only.
Molecular Constructor
Met1–Arg79
Product name ARO-P10464-1MG
Uniprot ID Q9ET35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MAMAFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKR
Molecular weight 11.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg79
Aliases /Synonyms CD267, Transmembrane activator and CAML interactor, Tumor necrosis factor receptor superfamily member 13B, TNFRSF13B, TACI
Reference ARO-P10464
Note For research use only.
Molecular Constructor
Met1–Arg79
Product name ARO-P10464-50
Uniprot ID Q9ET35
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MAMAFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKR
Molecular weight 11.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg79
Aliases /Synonyms CD267, Transmembrane activator and CAML interactor, Tumor necrosis factor receptor superfamily member 13B, TNFRSF13B, TACI
Reference ARO-P10464
Note For research use only.
Molecular Constructor
Met1–Arg79

Introduction to Recombinant Mouse CD267/TNFRSF13B Protein

Recombinant Mouse CD267/TNFRSF13B Protein, also known as B cell maturation antigen (BCMA), is a transmembrane protein that plays a crucial role in the development and survival of B cells. It is a member of the tumor necrosis factor receptor superfamily and is primarily expressed on mature B cells, plasma cells, and a subset of T cells. In this article, we will explore the structure, activity, and application of this important protein.

Structure of Recombinant Mouse CD267/TNFRSF13B Protein

The recombinant form of mouse CD267/TNFRSF13B protein is a 184 amino acid polypeptide with a molecular weight of approximately 21 kDa. It contains a single extracellular cysteine-rich domain, a transmembrane domain, and a cytoplasmic tail. The extracellular domain is responsible for binding to its ligands, while the cytoplasmic tail is involved in signal transduction.

Activity of Recombinant Mouse CD267/TNFRSF13B Protein

Recombinant Mouse CD267/TNFRSF13B Protein plays a critical role in B cell development and survival. It functions as a receptor for two ligands, B cell activating factor (BAFF) and a proliferation-inducing ligand (APRIL). Binding of these ligands to CD267/TNFRSF13B results in the activation of downstream signaling pathways, including the NF-κB and MAPK pathways, which promote B cell survival and proliferation.

In addition to its role in B cell development, CD267/TNFRSF13B has also been implicated in the pathogenesis of autoimmune diseases and B cell malignancies. Studies have shown that dysregulation of CD267/TNFRSF13B signaling can lead to the development of autoimmune diseases such as systemic lupus erythematosus and rheumatoid arthritis. It has also been found to be highly expressed in multiple myeloma, a type of B cell cancer, making it a potential therapeutic target for this disease.

Application of Recombinant Mouse CD267/TNFRSF13B Protein

The recombinant form of mouse CD267/TNFRSF13B protein has a wide range of applications in both basic research and clinical settings. One of its most common uses is in the study of B cell biology. Recombinant CD267/TNFRSF13B protein can be used to investigate the role of this receptor in B cell development, survival, and function. It can also be used to study the effects of its ligands, BAFF and APRIL, on B cell signaling and function.

In addition to its use in basic research, recombinant CD267/TNFRSF13B protein has potential clinical applications. Due to its involvement in autoimmune diseases and B cell malignancies, it has been explored as a potential therapeutic target. Several studies have shown promising results in using CD267/TNFRSF13B inhibitors to treat autoimmune diseases and B cell cancers. Recombinant CD267/TNFRSF13B protein can also be used in the development of diagnostic assays for these diseases.

Conclusion

In summary, Recombinant Mouse CD267/TNFRSF13B Protein is a crucial player in B cell biology, with important roles in development, survival, and function. Its dysregulation has been linked to autoimmune diseases and B cell malignancies, making it a potential therapeutic target for these diseases. The recombinant form of this protein has a wide range of applications in both basic research and clinical settings, making it a valuable tool for studying B cell biology and developing potential treatments for related diseases.

Recombinant Mouse CD267/TNFRSF13B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD267/TNFRSF13B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products